Ki Summary BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetAdenosine receptor A2
LigandBDBM50201006
Substrate/Competitorn/a
Meas. Tech.A2a Ki assay
Ki 0.200±n/a nM
Citation Ali, AKuang, RLim, YLo, MMTing, PCBiju, Pde Lera Ruiz, MDegrado, SJTung, ALHenderson, TJHong, LKim, JKim, DWLee, JWu, JWu, HXiao, YYu, TZhou, GZhu, XMcCormick, KDTagat, JRXiao, DKhan, TCao, JBerlin, MZhang, Y Aminoquinazoline compounds as A2A antagonist US Patent US10138212 Publication Date 11/27/2018
More Info.:Get all data from this article,  Assay Method
 
Adenosine receptor A2
Name:Adenosine receptors; A1 & A2a
Synonyms:A2A adenosine receptor (hA2A) | ADENOSINE A2 | ADENOSINE A2a | ADORA2 | ADORA2A | Adenosine A2A receptor (A2AAR)
Type:G Protein-Coupled Receptor (GPCR)
Mol. Mass.:44716.46
Organism:Homo sapiens (Human)
Description:P29274
Residue:412
Sequence:
MPIMGSSVYITVELAIAVLAILGNVLVCWAVWLNSNLQNVTNYFVVSLAAADIAVGVLAI
PFAITISTGFCAACHGCLFIACFVLVLTQSSIFSLLAIAIDRYIAIRIPLRYNGLVTGTR
AKGIIAICWVLSFAIGLTPMLGWNNCGQPKEGKNHSQGCGEGQVACLFEDVVPMNYMVYF
NFFACVLVPLLLMLGVYLRIFLAARRQLKQMESQPLPGERARSTLQKEVHAAKSLAIIVG
LFALCWLPLHIINCFTFFCPDCSHAPLWLMYLAIVLSHTNSVVNPFIYAYRIREFRQTFR
KIIRSHVLRQQEPFKAAGTSARVLAAHGSDGEQVSLRLNGHPPGVWANGSAPHPERRPNG
YALGLVSGGSAQESQGNTGLPDVELLSHELKGVCPEPPGLDDPLAQDGAGVS
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50201006
NameBDBM50201006
Synonyms:CHEMBL3923709 | US10138212, Example 5
TypeSmall organic molecule
Emp. Form.C19H21N5O2
Mol. Mass.351.4023
SMILESCOc1cccc2c(nc(N)nc12)C(=O)NCc1cccc(n1)C(C)C
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least:
n/a