Ki Summary BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetCyclin-dependent kinase 9
LigandBDBM307981
Substrate/Competitorn/a
Meas. Tech.TR-FRET Kinase Assay
IC50 2300±n/a nM
Citation Mastracchio, ABruncko, MLai, CMiyashiro, JMTao, ZWoods, KWPenning, TDSouers, AJ Pyridine CDK9 kinase inhibitors US Patent US9650358 Publication Date 5/16/2017
More Info.:Get all data from this article,  Assay Method
 
Cyclin-dependent kinase 9
Name:Cyclin-dependent kinase 9
Synonyms:C-2K | CDC2L4 | CDK9 | Cell division cycle 2-like protein kinase 4 | Cell division protein kinase 9 | Cyclin-Dependent Kinase 9 (CDK9) | Cyclin-dependent kinase 9 (CDK9) | Serine/threonine-protein kinase PITALRE | TAK | Tat-associated kinase complex catalytic subunit
Type:Enzyme Subunit
Mol. Mass.:42789.13
Organism:Homo sapiens (Human)
Description:n/a
Residue:372
Sequence:
MAKQYDSVECPFCDEVSKYEKLAKIGQGTFGEVFKARHRKTGQKVALKKVLMENEKEGFP
ITALREIKILQLLKHENVVNLIEICRTKASPYNRCKGSIYLVFDFCEHDLAGLLSNVLVK
FTLSEIKRVMQMLLNGLYYIHRNKILHRDMKAANVLITRDGVLKLADFGLARAFSLAKNS
QPNRYTNRVVTLWYRPPELLLGERDYGPPIDLWGAGCIMAEMWTRSPIMQGNTEQHQLAL
ISQLCGSITPEVWPNVDNYELYEKLELVKGQKRKVKDRLKAYVRDPYALDLIDKLLVLDP
AQRIDSDDALNHDFFWSDPMPSDLKGMLSTHLTSMFEYLAPPRRKGSQITQQSTNQSRNP
ATTNQTEFERVF
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM307981
NameBDBM307981
Synonyms:N-{5-chloro-4-[1-(3-fluorobenzyl)-1H-benzimidazol-6-yl]pyridin-2-yl}-3,4-dihydro-2H-pyrano[2,3-b]pyridine-6-carboxamide | US9650358, Example 277
TypeSmall organic molecule
Emp. Form.C28H21ClFN5O2
Mol. Mass.513.95
SMILESFc1cccc(Cn2cnc3ccc(cc23)-c2cc(NC(=O)c3cnc4OCCCc4c3)ncc2Cl)c1
Structure
n/a