Ki Summary BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetVasopressin V1a receptor
LigandBDBM316346
Substrate/Competitorn/a
Meas. Tech.Binding Assay
Ki 55±n/a nM
Citation Braje, WFroggett, JGeneste, HHornberger, WJantos, KKling, Avan Gaalen, M Fused heterocyclic or carbocyclic compounds carrying a substituted cycloaliphatic radical and use thereof for treating vasopressin-related diseases US Patent US9617226 Publication Date 4/11/2017
More Info.:Get all data from this article,  Assay Method
 
Vasopressin V1a receptor
Name:Vasopressin V1a receptor
Synonyms:AVPR V1a | AVPR1 | AVPR1A | Antidiuretic hormone receptor 1a | V1aR | VASOPRESSIN V1A | Vascular/hepatic-type arginine vasopressin receptor | Vasopressin V1 receptor
Type:Receptor
Mol. Mass.:46820.18
Organism:Homo sapiens (Human)
Description:P37288
Residue:418
Sequence:
MRLSAGPDAGPSGNSSPWWPLATGAGNTSREAEALGEGNGPPRDVRNEELAKLEIAVLAV
TFAVAVLGNSSVLLALHRTPRKTSRMHLFIRHLSLADLAVAFFQVLPQMCWDITYRFRGP
DWLCRVVKHLQVFGMFASAYMLVVMTADRYIAVCHPLKTLQQPARRSRLMIAAAWVLSFV
LSTPQYFVFSMIEVNNVTKARDCWATFIQPWGSRAYVTWMTGGIFVAPVVILGTCYGFIC
YNIWCNVRGKTASRQSKGAEQAGVAFQKGFLLAPCVSSVKSISRAKIRTVKMTFVIVTAY
IVCWAPFFIIQMWSVWDPMSVWTESENPTITITALLGSLNSCCNPWIYMFFSGHLLQDCV
QSFPCCQNMKEKFNKEDTDSMSRRQTFYSNNRSPTNSTGMWKDSPKSSKSIKFIPVST
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM316346
NameBDBM316346
Synonyms:US9617226, Example 27 | cis-2-[2-(3-Chlorophenyl)-4-oxo-6-[3-(1-piperidylmethyl)cyclobutyl]quinazolin-3-yl]-N-cyclopropyl-acetamide
TypeSmall organic molecule
Emp. Form.C29H33ClN4O2
Mol. Mass.505.051
SMILESClc1cccc(c1)-c1nc2ccc(cc2c(=O)n1CC(=O)NC1CC1)[C@@H]1C[C@H](CN2CCCCC2)C1 |r,wD:25.28,27.31,(-4,-.77,;-2.67,,;-2.67,1.54,;-1.33,2.31,;,1.54,;;-1.33,-.77,;1.33,-.77,;2.67,,;4,-.77,;5.33,,;6.67,-.77,;6.67,-2.31,;5.33,-3.08,;4,-2.31,;2.67,-3.08,;2.67,-4.62,;1.33,-2.31,;,-3.08,;,-4.62,;-1.33,-5.39,;1.33,-5.39,;1.33,-6.93,;2.1,-8.26,;.56,-8.26,;8,-3.08,;9.49,-2.68,;9.89,-4.17,;11.22,-4.94,;11.22,-6.48,;12.56,-7.25,;12.56,-8.79,;11.22,-9.56,;9.89,-8.79,;9.89,-7.25,;8.4,-4.57,)|
Structure
n/a