Ki Summary BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetEndothelial lipase
LigandBDBM319050
Substrate/Competitorn/a
Meas. Tech.Biological Activity
IC50 1.000±n/a nM
Citation Johnson, JAPi, ZQiao, JXKim, SWang, TCJiang, JFinlay, HLloyd, J Sulfone amide linked benzothiazole inhibitors of endothelial lipase US Patent US10173991 Publication Date 1/8/2019
More Info.:Get all data from this article,  Assay Method
 
Endothelial lipase
Name:Endothelial lipase
Synonyms:EDL | EL | Endothelial cell-derived lipase | LIPG
Type:Protein
Mol. Mass.:56805.62
Organism:Homo sapiens (Human)
Description:Q9Y5X9
Residue:500
Sequence:
MSNSVPLLCFWSLCYCFAAGSPVPFGPEGRLEDKLHKPKATQTEVKPSVRFNLRTSKDPE
HEGCYLSVGHSQPLEDCSFNMTAKTFFIIHGWTMSGIFENWLHKLVSALHTREKDANVVV
VDWLPLAHQLYTDAVNNTRVVGHSIARMLDWLQEKDDFSLGNVHLIGYSLGAHVAGYAGN
FVKGTVGRITGLDPAGPMFEGADIHKRLSPDDADFVDVLHTYTRSFGLSIGIQMPVGHID
IYPNGGDFQPGCGLNDVLGSIAYGTITEVVKCEHERAVHLFVDSLVNQDKPSFAFQCTDS
NRFKKGICLSCRKNRCNSIGYNAKKMRNKRNSKMYLKTRAGMPFRVYHYQMKIHVFSYKN
MGEIEPTFYVTLYGTNADSQTLPLEIVERIEQNATNTFLVYTEEDLGDLLKIQLTWEGAS
QSWYNLWKEFRSYLSQPRNPGRELNIRRIRVKSGETQRKLTFCTEDPENTSISPGRELWF
RKCRDGWRMKNETSPTVELP
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM319050
NameBDBM319050
Synonyms:N-[(cyclopropyl- carbamoyl) methyl]-2-(2- methoxyethane- sulfonyl)-2-{6[4- (1,3-oxazol-2-yl) phenyl]-1,3- benzothiazol-2-yl} acetamide | US10173991, Example 93
TypeSmall organic molecule
Emp. Form.C26H26N4O6S2
Mol. Mass.554.638
SMILESOCCCS(=O)(=O)C(C(=O)NCC(=O)NC1CC1)c1nc2ccc(cc2s1)-c1ccc(cc1)-c1ncco1
Structure
n/a