Ki Summary BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetAdenosine receptor A3
LigandBDBM333258
Substrate/Competitorn/a
Meas. Tech.Assay for Binding Affinity for Adenosine Receptor A3
IC50 5500±n/a nM
Citation Lee, JKim, SKim, DAhn, KLee, GKim, DHwang, H Compounds antagonizing A3 adenosine receptor, method for preparing them, and medical-use thereof US Patent US10196396 Publication Date 2/5/2019
More Info.:Get all data from this article,  Assay Method
 
Adenosine receptor A3
Name:Adenosine receptor A3
Synonyms:A3 adenosine receptor (hA3) | Adenosine A3 receptor (A3AR)
Type:G Protein-Coupled Receptor (GPCR)
Mol. Mass.:36197.32
Organism:Homo sapiens (Human)
Description:P0DMS8
Residue:318
Sequence:
MPNNSTALSLANVTYITMEIFIGLCAIVGNVLVICVVKLNPSLQTTTFYFIVSLALADIA
VGVLVMPLAIVVSLGITIHFYSCLFMTCLLLIFTHASIMSLLAIAVDRYLRVKLTVRYKR
VTTHRRIWLALGLCWLVSFLVGLTPMFGWNMKLTSEYHRNVTFLSCQFVSVMRMDYMVYF
SFLTWIFIPLVVMCAIYLDIFYIIRNKLSLNLSNSKETGAFYGREFKTAKSLFLVLFLFA
LSWLPLSIINCIIYFNGEVPQLVLYMGILLSHANSMMNPIVYAYKIKKFKETYLLILKAC
VVCHPSDSLDTSIEKNSE
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM333258
NameBDBM333258
Synonyms:(2S,3R,4S)-2-(8-hydroxy-[1,2,4]triazolo[4,3-a]pyrazin-3-yl)tetrahydrothiophene-3,4-diol | US10196396, Compound 53
TypeSmall organic molecule
Emp. Form.C9H10N4O3S
Mol. Mass.254.266
SMILESO[C@@H]1CS[C@H]([C@@H]1O)c1nnc2c(O)nccn12
Structure
n/a