Ki Summary BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetSerine/threonine-protein kinase Aurora-A
LigandBDBM14192
Substrate/CompetitorHistone H3
Meas. Tech.Aurora Kinase Inhibition Assay
pH7.5±n/a
Temperature295.15±n/a K
IC50 0.6±n/a nM
Citation Moriarty, KJKoblish, HKGarrabrant, TMaisuria, JKhalil, EAli, FPetrounia, IPCrysler, CSMaroney, ACJohnson, DLGalemmo, RA The synthesis and SAR of 2-amino-pyrrolo[2,3-d]pyrimidines: a new class of Aurora-A kinase inhibitors. Bioorg Med Chem Lett16:5778-83 (2006) [PubMed]  Article
More Info.:Get all data from this article,   Solution Info,  Assay Method
 
Serine/threonine-protein kinase Aurora-A
Name:Serine/threonine-protein kinase Aurora-A
Synonyms:Aurora Kinase A (Aurora-A) | Aurora kinase A | Aurora-family kinase 1 | Aurora/IPL1-related kinase 1 | Serine/threonine-protein kinase 6 | Serine/threonine-protein kinase Ayk1
Type:Enzyme
Mol. Mass.:44791.66
Organism:Mus musculus (mouse)
Description:n/a
Residue:395
Sequence:
MDRCKENCVSRPVKTTVPFGPKRVLVTEQIPSQNLGSASSGQAQRVLCPSNSQRVPSQAQ
KLGAGQKPAPKQLPAASVPRPVSRLNNPQKNEQPAASGNDSEKEQASLQKTEDTKKRQWT
LEDFDIGRPLGKGKFGNVYLARERQSKFILALKVLFKTQLEKANVEHQLRREVEIQSHLR
HPNILRLYGYFHDATRVYLILEYAPLGTVYRELQKLSKFDEQRTATYITELANALSYCHS
KRVIHRDIKPENLLLGSNGELKIADFGWSVHAPSSRRTTMCGTLDYLPPEMIEGRMHDEK
VDLWSLGVLCYEFLVGMPPFEAHTYQETYRRISRVEFTFPDFVTEGARDLISRLLKHNAS
QRLTLAEVLEHPWIKANSSKPPTGHTSKEPTSKSS
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM14192
NameBDBM14192
Synonyms:3-({7-cyclohexyl-7H-pyrrolo[2,3-d]pyrimidin-2-yl}amino)benzoic acid | pyrrolopyrimidine 15
TypeSmall organic molecule
Emp. Form.C19H20N4O2
Mol. Mass.336.3877
SMILESOC(=O)c1cccc(Nc2ncc3ccn(C4CCCCC4)c3n2)c1
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least:
Histone H3
Name:Histone H3
Synonyms:n/a
Type:Other Protein Type
Mol. Mass.:15425.07
Organism:Mus musculus (mouse)
Description:n/a
Residue:136
Sequence:
MARTKQTARKSTGGKAPRKQLATKAARKSAPATGGVKKPHRYRPGTVALREIRRYQKSTE
LLIRKLPFQRLVREIAQDFKTDLRFQSSAVMALQEACEAYLVGLFEDTNLCAIHAKRVTI
MPKDIQLARRIRGERA
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff: