Ki Summary BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetUrokinase-type plasminogen activator
LigandBDBM14352
Substrate/CompetitorBDBM13949
Meas. Tech.Enzyme Assay and Determination of the Inhibition Constants
Ki 2.2±n/a nM
Citation Katz, BAElrod, KVerner, EMackman, RLLuong, CShrader, WDSendzik, MSpencer, JRSprengeler, PAKolesnikov, ATai, VWHui, HCBreitenbucher, JGAllen, DJanc, JW Elaborate manifold of short hydrogen bond arrays mediating binding of active site-directed serine protease inhibitors. J Mol Biol329:93-120 (2003) [PubMed]
More Info.:Get all data from this article,   Solution Info,  Assay Method
 
Urokinase-type plasminogen activator
Name:Urokinase-type plasminogen activator/surface receptor
Synonyms:U-plasminogen activator | Urokinase | Urokinase-type plasminogen activator (uPA)
Type:Enzyme
Mol. Mass.:48528.62
Organism:Homo sapiens (Human)
Description:P00749
Residue:431
Sequence:
MRALLARLLLCVLVVSDSKGSNELHQVPSNCDCLNGGTCVSNKYFSNIHWCNCPKKFGGQ
HCEIDKSKTCYEGNGHFYRGKASTDTMGRPCLPWNSATVLQQTYHAHRSDALQLGLGKHN
YCRNPDNRRRPWCYVQVGLKPLVQECMVHDCADGKKPSSPPEELKFQCGQKTLRPRFKII
GGEFTTIENQPWFAAIYRRHRGGSVTYVCGGSLISPCWVISATHCFIDYPKKEDYIVYLG
RSRLNSNTQGEMKFEVENLILHKDYSADTLAHHNDIALLKIRSKEGRCAQPSRTIQTICL
PSMYNDPQFGTSCEITGFGKENSTDYLYPEQLKMTVVKLISHRECQQPHYYGSEVTTKML
CAADPQWKTDSCQGDSGGPLVCSLQGRMTLTGIVSWGRGCALKDKPGVYTRVSHFLPWIR
SHTKEENGLAL
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM14352
NameBDBM14352
Synonyms:2-{5-[amino(iminiumyl)methyl]-6-chloro-1H-indol-2-yl}-4-(dimethylcarbamoyl)-6-phenylbenzen-1-olate | CRA-11852
TypeSmall organic molecule
Emp. Form.C24H21ClN4O2
Mol. Mass.432.902
SMILESCN(C)C(=O)c1cc(-c2cc3cc(C(N)=[NH2+])c(Cl)cc3[nH]2)c([O-])c(c1)-c1ccccc1
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least:
BDBM13949
NameBDBM13949
Synonyms:(2S)-5-carbamimidamido-N-(4-nitrophenyl)-2-{2-[(2S)-2-(phenylformamido)propanamido]acetamido}pentanamide | Bz-Ala-Gly-Arg-pNA | uPA Chromogenic Substrate
TypeSmall organic molecule
Emp. Form.C24H30N8O6
Mol. Mass.526.545
SMILES[#6]-[#6@H](-[#7]-[#6](=O)-c1ccccc1)-[#6](=O)-[#7]-[#6]-[#6](=O)-[#7]-[#6@@H](-[#6]-[#6]-[#6]\[#7]=[#6](\[#7])-[#7])-[#6](=O)-[#7]-c1ccc(cc1)-[#7+](-[#8-])=O |r|
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least: