Ki Summary BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetUrokinase-type plasminogen activator
LigandBDBM14145
Substrate/CompetitorBDBM14484
Meas. Tech.Enzyme Assay and Determination of the Inhibition Constants
Ki 190±n/a nM
Citation Katz, BALuong, CHo, JDSomoza, JRGjerstad, ETang, JWilliams, SRVerner, EMackman, RLYoung, WBSprengeler, PAChan, HMortara, KJanc, JWMcGrath, ME Dissecting and designing inhibitor selectivity determinants at the S1 site using an artificial Ala190 protease (Ala190 uPA). J Mol Biol344:527-47 (2004) [PubMed]  Article
More Info.:Get all data from this article,   Solution Info,  Assay Method
 
Urokinase-type plasminogen activator
Name:Urokinase-type plasminogen activator/surface receptor
Synonyms:U-plasminogen activator | Urokinase | Urokinase-type plasminogen activator (uPA)
Type:Enzyme
Mol. Mass.:48528.62
Organism:Homo sapiens (Human)
Description:P00749
Residue:431
Sequence:
MRALLARLLLCVLVVSDSKGSNELHQVPSNCDCLNGGTCVSNKYFSNIHWCNCPKKFGGQ
HCEIDKSKTCYEGNGHFYRGKASTDTMGRPCLPWNSATVLQQTYHAHRSDALQLGLGKHN
YCRNPDNRRRPWCYVQVGLKPLVQECMVHDCADGKKPSSPPEELKFQCGQKTLRPRFKII
GGEFTTIENQPWFAAIYRRHRGGSVTYVCGGSLISPCWVISATHCFIDYPKKEDYIVYLG
RSRLNSNTQGEMKFEVENLILHKDYSADTLAHHNDIALLKIRSKEGRCAQPSRTIQTICL
PSMYNDPQFGTSCEITGFGKENSTDYLYPEQLKMTVVKLISHRECQQPHYYGSEVTTKML
CAADPQWKTDSCQGDSGGPLVCSLQGRMTLTGIVSWGRGCALKDKPGVYTRVSHFLPWIR
SHTKEENGLAL
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM14145
NameBDBM14145
Synonyms:2-{5-[amino(iminiumyl)methyl]-1H-1,3-benzodiazol-2-yl}-6-(2-methylpropoxy)benzen-1-olate | APC-10656 | CA-08
TypeSmall organic molecule
Emp. Form.C18H20N4O2
Mol. Mass.324.377
SMILESCC(C)COc1cccc(-c2nc3ccc(cc3[nH]2)C(N)=[NH2+])c1[O-]
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least:
BDBM14484
NameBDBM14484
Synonyms:4-{[({4-carbamimidamido-1-[(4-methyl-2-oxo-2H-chromen-7-yl)carbamoyl]butyl}carbamoyl)methyl]carbamoyl}butanoic acid hydrochloride | Glutaryl-Gly-Arg-7-amido-4-methylcoumarin | uPA Substrate
Typen/a
Emp. Form.n/a
Mol. Mass.n/a
SMILESn/a
Structure