Ki Summary BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetNuclear receptor ROR-gamma (RORC)
LigandBDBM344427
Substrate/Competitorn/a
Meas. Tech.Biochemical TR-FRET Assay
IC50 7.00±n/a nM
Citation Aicher, TDVanHuis, CAMacLean, JAndresen, BMBarr, KJBienstock, CDaniels, MLiu, KLiu, YWhite, CSciammetta, NSimov, V Carbamate benzoxazine propionic acids and acid derivatives for modulation of RORgamma activity and the treatment of disease US Patent US9783511 Publication Date 10/10/2017
More Info.:Get all data from this article,  Assay Method
 
Nuclear receptor ROR-gamma (RORC)
Name:Nuclear receptor ROR-gamma (RORC)
Synonyms:NR1F3 | Nuclear receptor ROR-gamma | Nuclear receptor subfamily 1 group F member 3 | RAR-related orphan receptor C (RORc) | RORC | RORG | RZRG | Retinoid-related orphan receptor-gamma | Retinoid-related orphan receptor-gamma (RORc)
Type:Enzyme Catalytic Domain
Mol. Mass.:58218.40
Organism:Homo sapiens (Human)
Description:P51449
Residue:518
Sequence:
MDRAPQRQHRASRELLAAKKTHTSQIEVIPCKICGDKSSGIHYGVITCEGCKGFFRRSQR
CNAAYSCTRQQNCPIDRTSRNRCQHCRLQKCLALGMSRDAVKFGRMSKKQRDSLHAEVQK
QLQQRQQQQQEPVVKTPPAGAQGADTLTYTLGLPDGQLPLGSSPDLPEASACPPGLLKAS
GSGPSYSNNLAKAGLNGASCHLEYSPERGKAEGRESFYSTGSQLTPDRCGLRFEEHRHPG
LGELGQGPDSYGSPSFRSTPEAPYASLTEIEHLVQSVCKSYRETCQLRLEDLLRQRSNIF
SREEVTGYQRKSMWEMWERCAHHLTEAIQYVVEFAKRLSGFMELCQNDQIVLLKAGAMEV
VLVRMCRAYNADNRTVFFEGKYGGMELFRALGCSELISSIFDFSHSLSALHFSEDEIALY
TALVLINAHRPGLQEKRKVEQLQYNLELAFHHHLCKTHRQSILAKLPPKGKLRSLCSQHV
ERLQIFQHLHPIVVQAAFPPLYKELFSTETESPVGLSK
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM344427
NameBDBM344427
Synonyms:(R)-3-((S)-4-((3-chloro-4-fluorophenyl)sulfonyl)-6-((((1,1,1-trifluoro-2-methylpropan-2-yl)oxy)carbonyl)amino)-3,4-dihydro-2H-benzo[b][1,4]oxazin-2-yl)-2-methylpropanoic acid | US9783511, 2A | US9783511, 5A
TypeSmall organic molecule
Emp. Form.C23H23ClF4N2O7S
Mol. Mass.582.95
SMILESC[C@H](C[C@H]1CN(c2cc(NC(=O)OC(C)(C)C(F)(F)F)ccc2O1)S(=O)(=O)c1ccc(F)c(Cl)c1)C(O)=O
Structure
n/a