Ki Summary BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetGlucagon-like peptide 1 receptor
LigandBDBM349695
Substrate/Competitorn/a
Meas. Tech.CHO GLP-1R Clone H6-Assay 1
EC50 340±n/a nM
Citation Aspnes, GEBagley, SWCurto, JMDowling, MSEdmonds, DFlanagan, MEFutatsugi, KGriffith, DAHuard, KIngle, GJiao, WLimberakis, CMathiowetz, AMPiotrowski, DWRuggeri, RB GLP-1 receptor agonists and uses thereof US Patent US10208019 Publication Date 2/19/2019
More Info.:Get all data from this article,  Assay Method
 
Glucagon-like peptide 1 receptor
Name:Glucagon-like peptide 1 receptor
Synonyms:GLP-1 receptor | GLP-1-R | GLP-1R | Glucagon-like peptide 1 receptor
Type:Enzyme
Mol. Mass.:53035.78
Organism:Homo sapiens (Human)
Description:P43220
Residue:463
Sequence:
MAGAPGPLRLALLLLGMVGRAGPRPQGATVSLWETVQKWREYRRQCQRSLTEDPPPATDL
FCNRTFDEYACWPDGEPGSFVNVSCPWYLPWASSVPQGHVYRFCTAEGLWLQKDNSSLPW
RDLSECEESKRGERSSPEEQLLFLYIIYTVGYALSFSALVIASAILLGFRHLHCTRNYIH
LNLFASFILRALSVFIKDAALKWMYSTAAQQHQWDGLLSYQDSLSCRLVFLLMQYCVAAN
YYWLLVEGVYLYTLLAFSVLSEQWIFRLYVSIGWGVPLLFVVPWGIVKYLYEDEGCWTRN
SNMNYWLIIRLPILFAIGVNFLIFVRVICIVVSKLKANLMCKTDIKCRLAKSTLTLIPLL
GTHEVIFAFVMDEHARGTLRFIKLFTELSFTSFQGLMVAILYCFVNNEVQLEFRKSWERW
RLEHLHIQRDSSMKPLKCPTSSLSSGATAGSSMYTATCQASCS
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM349695
NameBDBM349695
Synonyms:2-[(4-{6-[(4-chloro-2-fluorobenzyl)oxy]pyridin-2-yl}piperidin-1-yl)methyl]-1,5-dimethyl-1H-imidazo[4,5-b]pyridine-6-carboxylic acid | US10208019, Example 2A-12
TypeSmall organic molecule
Emp. Form.C27H27ClFN5O3
Mol. Mass.523.986
SMILESCc1nc2nc(CN3CCC(CC3)c3cccc(OCc4ccc(Cl)cc4F)n3)n(C)c2cc1C(O)=O
Structure
n/a