Ki Summary BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetAldose reductase (AR)
LigandBDBM16495
Substrate/CompetitorBDBM16241
Meas. Tech.Enzyme Inhibition Assay
IC50 163±n/a nM
Citation Van Zandt, MCJones, MLGunn, DEGeraci, LSJones, JHSawicki, DRSredy, JJacot, JLDicioccio, ATPetrova, TMitschler, APodjarny, AD Discovery of 3-[(4,5,7-trifluorobenzothiazol-2-yl)methyl]indole-N-acetic acid (lidorestat) and congeners as highly potent and selective inhibitors of aldose reductase for treatment of chronic diabetic complications. J Med Chem48:3141-52 (2005) [PubMed]  Article
More Info.:Get all data from this article,   Solution Info,  Assay Method
 
Aldose reductase (AR)
Name:Aldose reductase
Synonyms:AR | Aldo-keto reductase family 1 member B1 (AKR1B1) | Aldose Reductase (ALR2) | Aldose reductase
Type:Protein
Mol. Mass.:35855.50
Organism:Homo sapiens (Human)
Description:P15121. 4LAU; 2IKI; 4LB4; 2FZD; 2FZ8; 1US0
Residue:316
Sequence:
MASRLLLNNGAKMPILGLGTWKSPPGQVTEAVKVAIDVGYRHIDCAHVYQNENEVGVAIQ
EKLREQVVKREELFIVSKLWCTYHEKGLVKGACQKTLSDLKLDYLDLYLIHWPTGFKPGK
EFFPLDESGNVVPSDTNILDTWAAMEELVDEGLVKAIGISNFNHLQVEMILNKPGLKYKP
AVNQIECHPYLTQEKLIQYCQSKGIVVTAYSPLGSPDRPWAKPEDPSLLEDPRIKAIAAK
HNKTTAQVLIRFPMQRNLVVIPKSVTPERIAENFKVFDFELSSQDMTTLLSYNRNWRVCA
LLSCTSHKDYPFHEEF
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM16495
NameBDBM16495
Synonyms:2-{3-[(4,5,7-trifluoro-1,3-benzothiazol-2-yl)methyl]-1H-indol-1-yl}propanoic acid | Indoleacetic Acid Inhibitor 51
TypeSmall organic molecule
Emp. Form.C19H13F3N2O2S
Mol. Mass.390.379
SMILESCC(C(O)=O)n1cc(Cc2nc3c(F)c(F)cc(F)c3s2)c2ccccc12
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least:
BDBM16241
NameBDBM16241
Synonyms:2,3-dihydroxypropanal | D,L-glyceraldehyde | Glycerinformal | Glycerose
TypeSmall organic molecule
Emp. Form.C3H6O3
Mol. Mass.90.0779
SMILESOCC(O)C=O
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least: