Ki Summary BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetAldose reductase (AR)
LigandBDBM16457
Substrate/CompetitorBDBM16443
Meas. Tech.In Vitro Aldose Reductase Inhibition Assay
IC50 25±n/a nM
Citation Mylari, BLArmento, SJBeebe, DAConn, ELCoutcher, JBDina, MSO'Gorman, MTLinhares, MCMartin, WHOates, PJTess, DAWithbroe, GJZembrowski, WJ A novel series of non-carboxylic acid, non-hydantoin inhibitors of aldose reductase with potent oral activity in diabetic rat models: 6-(5-chloro-3-methylbenzofuran-2-sulfonyl)-2H-pyridazin-3-one and congeners. J Med Chem48:6326-39 (2005) [PubMed]  Article
More Info.:Get all data from this article,   Solution Info,  Assay Method
 
Aldose reductase (AR)
Name:Aldose reductase
Synonyms:AR | Aldo-keto reductase family 1 member B1 (AKR1B1) | Aldose Reductase (ALR2) | Aldose reductase
Type:Protein
Mol. Mass.:35855.50
Organism:Homo sapiens (Human)
Description:P15121. 4LAU; 2IKI; 4LB4; 2FZD; 2FZ8; 1US0
Residue:316
Sequence:
MASRLLLNNGAKMPILGLGTWKSPPGQVTEAVKVAIDVGYRHIDCAHVYQNENEVGVAIQ
EKLREQVVKREELFIVSKLWCTYHEKGLVKGACQKTLSDLKLDYLDLYLIHWPTGFKPGK
EFFPLDESGNVVPSDTNILDTWAAMEELVDEGLVKAIGISNFNHLQVEMILNKPGLKYKP
AVNQIECHPYLTQEKLIQYCQSKGIVVTAYSPLGSPDRPWAKPEDPSLLEDPRIKAIAAK
HNKTTAQVLIRFPMQRNLVVIPKSVTPERIAENFKVFDFELSSQDMTTLLSYNRNWRVCA
LLSCTSHKDYPFHEEF
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM16457
NameBDBM16457
Synonyms:6-[(5-chloro-1-benzofuran-2-)sulfonyl]-2,3-dihydropyridazin-3-one | CHEMBL240722 | Heterocyclic Sulfonylpyridazinone, 19i | benzofuran, 23
TypeSmall organic molecule
Emp. Form.C12H7ClN2O4S
Mol. Mass.310.713
SMILESClc1ccc2oc(cc2c1)S(=O)(=O)c1ccc(=O)[nH]n1
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least:
BDBM16443
NameBDBM16443
Synonyms:(2R)-2,3-dihydroxypropanal | D-glyceraldehyde | Triose
TypeSmall organic molecule
Emp. Form.C3H6O3
Mol. Mass.90.0779
SMILESOC[C@@H](O)C=O
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least: