Ki Summary BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetCoagulation factor X
LigandBDBM17090
Substrate/CompetitorBDBM12658
Meas. Tech.Enzyme Inhibition Assay
pH7.5±n/a
Temperature295.15±n/a K
Ki 2.5±0.2 nM
Citation Ye, BArnaiz, DOChou, YLGriedel, BDKaranjawala, RLee, WMorrissey, MMSacchi, KLSakata, STShaw, KJWu, SCZhao, ZAdler, MCheeseman, SDole, WPEwing, JFitch, RLentz, DLiang, ALight, DMorser, JPost, JRumennik, GSubramanyam, BSullivan, MEVergona, RWalters, JWang, YXWhite, KAWhitlow, MKochanny, MJ Thiophene-anthranilamides as highly potent and orally available factor xa inhibitors J Med Chem50:2967-80 (2007) [PubMed]  Article
More Info.:Get all data from this article,  Inhibition_Run data,   Solution Info,  Assay Method
 
Coagulation factor X
Name:Coagulation factor X
Synonyms:Coagulation factor X precursor | F10 | Factor Xa (fXa) | Stuart factor
Type:Enzyme
Mol. Mass.:54255.03
Organism:Rattus norvegicus (rat)
Description:n/a
Residue:482
Sequence:
MESPVRLSLLYVVLASLLLPGRSVFINRERANNVLQRIRRANSFFEEIKKGNLERECVEE
ICSFEEAREVFEDNEKTTEFWNKYEDGDQCESSPCQNQGECRDGLGSYTCTCTEGFEGKN
CELFVRKLCSLDNGDCDQFCREEQNSVVCSCAKGYFLGNDGKSCLSTAPFPCGKTNKGRA
KRSVALNTSNSEPDPEDLMPDADILYPTESPSELLNLNKTEPEANSDDVIRIVGGQECKR
GECPWQALLFSDEETDGFCGGTILNEFYILTAAHCLHQAKRFKVRVGDLNTEQEDGGEMV
HEVDMIIKHNKFQRDTYDFDIAMLRLKTPITFRENVAPACLPQKDWAEATLMTQKTGIVS
GFGRTHEKGRQSKVLKMMEVPYVDRNTCRLSTSFSITQNMFCAGYDAKQEDACQGDSGGP
HVTRFKDTYFVTGIVSWGEGCARKGKYGIYTKVTAFLKWIDRSMKARVGPTSETPRLTHP
PY
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM17090
NameBDBM17090
Synonyms:3-chloro-N-{4-chloro-2-[(5-chloropyridin-2-yl)carbamoyl]-6-methoxyphenyl}-4-[(methylamino)methyl]thiophene-2-carboxamide | Thiophene-Anthranilamide, 10b | ZK 814048 | ZK814048
TypeSmall organic molecule
Emp. Form.C20H17Cl3N4O3S
Mol. Mass.499.798
SMILESCNCc1csc(C(=O)Nc2c(OC)cc(Cl)cc2C(=O)Nc2ccc(Cl)cn2)c1Cl
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least:
BDBM12658
NameBDBM12658
Synonyms:4-[({[(1S)-4-carbamimidamido-1-[(4-nitrophenyl)carbamoyl]butyl]carbamoyl}methyl)carbamoyl]-4-[(2S,3S)-3-methyl-2-(phenylformamido)pentanamido]butanoic acid hydrochloride | Bz-Ile-Glu-Gly-Arg-pNA | Chromogenic Substrate S-2222 | L-Argininamide, N-benzoyl-L-isoleucyl-L-alpha-glutamylglycyl-N-(4-nitrophenyl)-, monohydrochloride | benzoyl-Ile-Glu-Gly-Arg-p-nitroanilide
TypeSmall organic molecule
Emp. Form.C32H43N9O9
Mol. Mass.697.7387
SMILES[#6]-[#6]-[#6@H](-[#6])-[#6@H](-[#7]-[#6](=O)-c1ccccc1)-[#6](=O)-[#7]-[#6@@H](-[#6]-[#6]-[#6](-[#8])=O)-[#6](=O)-[#7]-[#6]-[#6](=O)-[#7]-[#6@@H](-[#6]-[#6]-[#6]\[#7]=[#6](\[#7])-[#7])-[#6](=O)-[#7]-c1ccc(cc1)-[#7+](-[#8-])=O |r|
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least: