Ki Summary BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetFactor Xa (fXa)
LigandBDBM17135
Substrate/CompetitorBDBM12658
Meas. Tech.Enzyme Inhibition Assay
Ki 0.31±n/a nM
Citation Ye, BArnaiz, DOChou, YLGriedel, BDKaranjawala, RLee, WMorrissey, MMSacchi, KLSakata, STShaw, KJWu, SCZhao, ZAdler, MCheeseman, SDole, WPEwing, JFitch, RLentz, DLiang, ALight, DMorser, JPost, JRumennik, GSubramanyam, BSullivan, MEVergona, RWalters, JWang, YXWhite, KAWhitlow, MKochanny, MJ Thiophene-anthranilamides as highly potent and orally available factor xa inhibitors J Med Chem50:2967-80 (2007) [PubMed]  Article
More Info.:Get all data from this article,   Solution Info,  Assay Method
 
Factor Xa (fXa)
Name:Factor Xa (fXa)
Synonyms:Coagulation factor X precursor | Stuart factor | Stuart-Prower factor
Type:Enzyme
Mol. Mass.:17844.67
Organism:Canis lupus familiaris (Dog)
Description:n/a
Residue:159
Sequence:
ILSEYYILTAAHCLQQAKKFTVRVGERDTDKEEGNEVAHEVEMIIKHNKFVRETYDFDIA
VIKLKTPITFRMNVAPACLPQKDWAESTLMTQKTGIVSGFGKTHEKGRPSTTLKMMEVPY
VDRNTCKLSSSFSITQNMFCAGYDSKPEDGCQGDSGGPH
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM17135
NameBDBM17135
Synonyms:3-chloro-N-{4-chloro-2-[(5-chloropyridin-2-yl)carbamoyl]-6-methoxyphenyl}-4-{[2-(methylamino)-1H-imidazol-1-yl]methyl}thiophene-2-carboxamide | Thiophene-Anthranilamide, 17m | ZK 813039 | ZK813039
TypeSmall organic molecule
Emp. Form.C23H19Cl3N6O3S
Mol. Mass.565.859
SMILESCNc1nccn1Cc1csc(C(=O)Nc2c(OC)cc(Cl)cc2C(=O)Nc2ccc(Cl)cn2)c1Cl
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least:
BDBM12658
NameBDBM12658
Synonyms:4-[({[(1S)-4-carbamimidamido-1-[(4-nitrophenyl)carbamoyl]butyl]carbamoyl}methyl)carbamoyl]-4-[(2S,3S)-3-methyl-2-(phenylformamido)pentanamido]butanoic acid hydrochloride | Bz-Ile-Glu-Gly-Arg-pNA | Chromogenic Substrate S-2222 | L-Argininamide, N-benzoyl-L-isoleucyl-L-alpha-glutamylglycyl-N-(4-nitrophenyl)-, monohydrochloride | benzoyl-Ile-Glu-Gly-Arg-p-nitroanilide
TypeSmall organic molecule
Emp. Form.C32H43N9O9
Mol. Mass.697.7387
SMILES[#6]-[#6]-[#6@H](-[#6])-[#6@H](-[#7]-[#6](=O)-c1ccccc1)-[#6](=O)-[#7]-[#6@@H](-[#6]-[#6]-[#6](-[#8])=O)-[#6](=O)-[#7]-[#6]-[#6](=O)-[#7]-[#6@@H](-[#6]-[#6]-[#6]\[#7]=[#6](\[#7])-[#7])-[#6](=O)-[#7]-c1ccc(cc1)-[#7+](-[#8-])=O |r|
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least: