Ki Summary BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetE3 ubiquitin-protein ligase XIAP [241-356]
LigandBDBM17336
Substrate/CompetitorBDBM17337
Meas. Tech.Competitive Fluorescent-binding Assay
pH7±n/a
Temperature295.15±n/a K
Kd 11000±3000 nM
Citation Wist, ADGu, LRiedl, SJShi, YMcLendon, GL Structure-activity based study of the Smac-binding pocket within the BIR3 domain of XIAP. Bioorg Med Chem15:2935-43 (2007) [PubMed]  Article
More Info.:Get all data from this article,   Solution Info,  Assay Method
 
E3 ubiquitin-protein ligase XIAP [241-356]
Name:E3 ubiquitin-protein ligase XIAP [241-356]
Synonyms:BIR3 domain of X-linked inhibitor of apoptosis protein | E3 ubiquitin-protein ligase (XIAP-BIR3) | E3 ubiquitin-protein ligase XIAP BIR-3 | E3 ubiquitin-protein ligase XIAP BIR3 | X chromosome-linked inhibitor of apoptosis BIR3 domain (XIAP BIR3) | X-linked inhibitor of apoptosis protein BIR3 domain (XIAP BIR-3) | XIAP-BIR3 | baculovirus IAP repeat 3 (BIR3) domain of XIAP
Type:Protein Binding Domain
Mol. Mass.:13276.62
Organism:Homo sapiens (Human)
Description:BIR3 of XIAP: RESIDUES 241-356.
Residue:116
Sequence:
SDAVSSDRNFPNSTNLPRNPSMADYEARIFTFGTWIYSVNKEQLARAGFYALGEGDKVKC
FHCGGGLTDWKPSEDPWEQHAKWYPGCKYLLEQKGQEYINNIHLTHSLEECLVRTT
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM17336
NameBDBM17336
Synonyms:(2S)-2-{[(2S)-1-({2-[(1S)-1-aminoethyl]-1,3-oxazol-4-yl}carbonyl)pyrrolidin-2-yl]formamido}-3-phenylpropanoic acid | AoxSPF
TypeSmall organic molecule
Emp. Form.C20H24N4O5
Mol. Mass.400.4284
SMILESC[C@H](N)c1nc(co1)C(=O)N1CCC[C@H]1C(=O)N[C@@H](Cc1ccccc1)C(O)=O |r|
Structure
BDBM17337
NameBDBM17337
Synonyms:3-({2-[6-(dimethylamino)naphthalen-2-yl]-2-oxoethyl}sulfanyl)-2-({1-[2-(1-formamidoethan-1-aminium)-3-methylbutanoyl]pyrrolidin-2-yl}formamido)propanoate | AVPC-BADAN
TypeFluorescent dye-conjugated peptide
Emp. Form.C30H41N5O6S
Mol. Mass.599.741
SMILESCC(C)C(NC(=O)C(C)[NH3+])C(=O)N1CCCC1C(=O)NC(CSCC(=O)c1ccc2cc(ccc2c1)N(C)C)C([O-])=O
Structure