Reaction Details |
 | Report a problem with these data |
Target | E3 ubiquitin-protein ligase XIAP [241-356] |
---|
Ligand | BDBM17339 |
---|
Substrate/Competitor | BDBM17337 |
---|
Meas. Tech. | Competitive Fluorescent-binding Assay |
---|
pH | 7±n/a |
---|
Temperature | 295.15±n/a K |
---|
Kd | 120000±60000 nM |
---|
Citation | Wist, AD; Gu, L; Riedl, SJ; Shi, Y; McLendon, GL Structure-activity based study of the Smac-binding pocket within the BIR3 domain of XIAP. Bioorg Med Chem15:2935-43 (2007) [PubMed] Article |
---|
More Info.: | Get all data from this article, Solution Info, Assay Method |
---|
|
E3 ubiquitin-protein ligase XIAP [241-356] |
---|
Name: | E3 ubiquitin-protein ligase XIAP [241-356] |
Synonyms: | BIR3 domain of X-linked inhibitor of apoptosis protein | E3 ubiquitin-protein ligase (XIAP-BIR3) | E3 ubiquitin-protein ligase XIAP BIR-3 | E3 ubiquitin-protein ligase XIAP BIR3 | X chromosome-linked inhibitor of apoptosis BIR3 domain (XIAP BIR3) | X-linked inhibitor of apoptosis protein BIR3 domain (XIAP BIR-3) | XIAP-BIR3 | baculovirus IAP repeat 3 (BIR3) domain of XIAP |
Type: | Protein Binding Domain |
Mol. Mass.: | 13276.62 |
Organism: | Homo sapiens (Human) |
Description: | BIR3 of XIAP: RESIDUES 241-356. |
Residue: | 116 |
Sequence: | SDAVSSDRNFPNSTNLPRNPSMADYEARIFTFGTWIYSVNKEQLARAGFYALGEGDKVKC
FHCGGGLTDWKPSEDPWEQHAKWYPGCKYLLEQKGQEYINNIHLTHSLEECLVRTT
|
|
|
BDBM17339 |
---|
Name | BDBM17339 |
Synonyms: | (2S)-2-{[(2S)-1-({2-[(1S)-1-aminoethyl]-1,3-oxazol-4-yl}carbonyl)pyrrolidin-2-yl]formamido}-3-(4-hydroxyphenyl)propanoic acid | AoxSPY |
Type | Small organic molecule |
Emp. Form. | C20H24N4O6 |
Mol. Mass. | 416.4278 |
SMILES | C[C@H](N)c1nc(co1)C(=O)N1CCC[C@H]1C(=O)N[C@@H](Cc1ccc(O)cc1)C(O)=O |r| |
Structure |  |
BDBM17337 |
---|
Name | BDBM17337 |
Synonyms: | 3-({2-[6-(dimethylamino)naphthalen-2-yl]-2-oxoethyl}sulfanyl)-2-({1-[2-(1-formamidoethan-1-aminium)-3-methylbutanoyl]pyrrolidin-2-yl}formamido)propanoate | AVPC-BADAN |
Type | Fluorescent dye-conjugated peptide |
Emp. Form. | C30H41N5O6S |
Mol. Mass. | 599.741 |
SMILES | CC(C)C(NC(=O)C(C)[NH3+])C(=O)N1CCCC1C(=O)NC(CSCC(=O)c1ccc2cc(ccc2c1)N(C)C)C([O-])=O |
Structure |  |