Ki Summary BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetCathepsin K
LigandBDBM19854
Substrate/CompetitorBDBM19480
Meas. Tech.Enzyme Inhibition Assay
pH5.5±n/a
Temperature295.15±n/a K
IC50 0.25±n/a nM
Citation Falgueyret, JPDesmarais, SOballa, RBlack, WCCromlish, WKhougaz, KLamontagne, SMassé, FRiendeau, DToulmond, SPercival, MD Lysosomotropism of basic cathepsin K inhibitors contributes to increased cellular potencies against off-target cathepsins and reduced functional selectivity. J Med Chem48:7535-43 (2005) [PubMed]  Article
More Info.:Get all data from this article,   Solution Info,  Assay Method
 
Cathepsin K
Name:Cathepsin K
Synonyms:n/a
Type:Enzyme
Mol. Mass.:36879.51
Organism:Oryctolagus cuniculus (rabbit)
Description:n/a
Residue:329
Sequence:
MWGLKVLLLPVVSFALHPEEILDTQWELWKKTYSKQYNSKVDEISRRLIWEKNLKHISIH
NLEASLGVHTYELAMNHLGDMTSEEVVQKMTGLKVPPSRSHSNDTLYIPDWEGRTPDSID
YRKKGYVTPVKNQGQCGSCWAFSSVGALEGQLKKKTGKLLNLSPQNLVDCVSENYGCGGG
YMTNAFQYVQRNRGIDSEDAYPYVGQDESCMYNPTGKAAKCRGYREIPEGNEKALKRAVA
RVGPVSVAIDASLTSFQFYSKGVYYDENCSSDNVNHAVLAVGYGIQKGNKHWIIKNSWGE
SWGNKGYILMARNKNNACGIANLASFPKM
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM19854
NameBDBM19854
Synonyms:CHEMBL426819 | CRA-013783/L-006235 | N-{1-[(cyanomethyl)carbamoyl]cyclohexyl}-4-[2-(4-methylpiperazin-1-yl)-1,3-thiazol-4-yl]benzamide | basic piperazine-containing compound, 1
TypeSmall organic molecule
Emp. Form.C24H30N6O2S
Mol. Mass.466.599
SMILESCN1CCN(CC1)c1nc(cs1)-c1ccc(cc1)C(=O)NC1(CCCCC1)C(=O)NCC#N
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least:
BDBM19480
NameBDBM19480
Synonyms:Cbz-Leu-Arg-AMC | Fluorogenic substrate | Z-Leu-Arg-AMC
Typen/a
Emp. Form.n/a
Mol. Mass.n/a
SMILESn/a
Structure