Ki Summary BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
Targetpoly(ADP-ribose) glycohydrolase (PARG)
LigandBDBM371267
Substrate/Competitorn/a
Meas. Tech.PARG Assay
IC50 11.0±n/a nM
Citation McGonagle, AEJordan, AWaszkowycz, BHutton, CWaddell, IHitchin, JRSmith, KMHamilton, NM 2,4-dioxo-quinazoline-6-sulfonamide derivatives as inhibitors of PARG US Patent US10239843 Publication Date 3/26/2019
More Info.:Get all data from this article,  Assay Method
 
poly(ADP-ribose) glycohydrolase (PARG)
Name:poly(ADP-ribose) glycohydrolase (PARG)
Synonyms:Poly(ADP-ribose) glycohydrolase
Type:Protein
Mol. Mass.:111107.13
Organism:Homo sapiens (Human)
Description:Q86W56
Residue:976
Sequence:
MNAGPGCEPCTKRPRWGAATTSPAASDARSFPSRQRRVLDPKDAHVQFRVPPSSPACVPG
RAGQHRGSATSLVFKQKTITSWMDTKGIKTAESESLDSKENNNTRIESMMSSVQKDNFYQ
HNVEKLENVSQLSLDKSPTEKSTQYLNQHQTAAMCKWQNEGKHTEQLLESEPQTVTLVPE
QFSNANIDRSPQNDDHSDTDSEENRDNQQFLTTVKLANAKQTTEDEQAREAKSHQKCSKS
CDPGEDCASCQQDEIDVVPESPLSDVGSEDVGTGPKNDNKLTRQESCLGNSPPFEKESEP
ESPMDVDNSKNSCQDSEADEETSPGFDEQEDGSSSQTANKPSRFQARDADIEFRKRYSTK
GGEVRLHFQFEGGESRTGMNDLNAKLPGNISSLNVECRNSKQHGKKDSKITDHFMRLPKA
EDRRKEQWETKHQRTERKIPKYVPPHLSPDKKWLGTPIEEMRRMPRCGIRLPLLRPSANH
TVTIRVDLLRAGEVPKPFPTHYKDLWDNKHVKMPCSEQNLYPVEDENGERTAGSRWELIQ
TALLNKFTRPQNLKDAILKYNVAYSKKWDFTALIDFWDKVLEEAEAQHLYQSILPDMVKI
ALCLPNICTQPIPLLKQKMNHSITMSQEQIASLLANAFFCTFPRRNAKMKSEYSSYPDIN
FNRLFEGRSSRKPEKLKTLFCYFRRVTEKKPTGLVTFTRQSLEDFPEWERCEKPLTRLHV
TYEGTIEENGQGMLQVDFANRFVGGGVTSAGLVQEEIRFLINPELIISRLFTEVLDHNEC
LIITGTEQYSEYTGYAETYRWSRSHEDGSERDDWQRRCTEIVAIDALHFRRYLDQFVPEK
MRRELNKAYCGFLRPGVSSENLSAVATGNWGCGAFGGDARLKALIQILAAAAAERDVVYF
TFGDSELMRDIYSMHIFLTERKLTVGDVYKLLLRYYNEECRNCSTPGPDIKLYPFIYHAV
ESCAETADHSGQRTGT
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM371267
NameBDBM371267
Synonyms:US10239843, Example 374
TypeSmall organic molecule
Emp. Form.C23H23N7O5S
Mol. Mass.509.538
SMILESCc1nc(C)c(Cn2c3ccc(cc3c(=O)n(Cc3cnn(C)c3)c2=O)S(=O)(=O)NC2(CC2)C#N)o1
Structure
n/a