Ki Summary BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetBeta-1 adrenergic receptor
LigandBDBM25766
Substrate/CompetitorBDBM25747
Meas. Tech.3H-CGP 12177 Whole Cell Binding Assay
pH7.4±n/a
Temperature310.15±n/a K
Kd 59±5 nM
Citation Baker, JG The selectivity of beta-adrenoceptor antagonists at the human beta1, beta2 and beta3 adrenoceptors. Br J Pharmacol144:317-22 (2005) [PubMed]  Article
More Info.:Get all data from this article,   Solution Info,  Assay Method
 
Beta-1 adrenergic receptor
Name:Beta-1 adrenergic receptor
Synonyms:ADRB1 | ADRB1R | B1AR | Beta-1 adrenoceptor | adrenergic Beta1
Type:G Protein-Coupled Receptor (GPCR)
Mol. Mass.:51338.40
Organism:Homo sapiens (Human)
Description:P08588
Residue:477
Sequence:
MGAGVLVLGASEPGNLSSAAPLPDGAATAARLLVPASPPASLLPPASESPEPLSQQWTAG
MGLLMALIVLLIVAGNVLVIVAIAKTPRLQTLTNLFIMSLASADLVMGLLVVPFGATIVV
WGRWEYGSFFCELWTSVDVLCVTASIETLCVIALDRYLAITSPFRYQSLLTRARARGLVC
TVWAISALVSFLPILMHWWRAESDEARRCYNDPKCCDFVTNRAYAIASSVVSFYVPLCIM
AFVYLRVFREAQKQVKKIDSCERRFLGGPARPPSPSPSPVPAPAPPPGPPRPAAAAATAP
LANGRAGKRRPSRLVALREQKALKTLGIIMGVFTLCWLPFFLANVVKAFHRELVPDRLFV
FFNWLGYANSAFNPIIYCRSPDFRKAFQRLLCCARRAARRRHATHGDRPRASGCLARPGP
PPSPGAASDDDDDDVVGATPPARLLEPWAGCNGGAAADSDSSLDEPCRPGFASESKV
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM25766
NameBDBM25766
Synonyms:(2R,3S)-5-[3-(tert-butylamino)-2-hydroxypropoxy]-1,2,3,4-tetrahydronaphthalene-2,3-diol | CHEMBL649 | Corgard | Nadolol | Solgol | cid_39147
TypeSmall organic molecule
Emp. Form.C17H27NO4
Mol. Mass.309.4006
SMILESCC(C)(C)NCC(O)COc1cccc2C[C@@H](O)[C@@H](O)Cc12
Structure
BDBM25747
NameBDBM25747
Synonyms:4-[3-(tert-butylamino)-2-hydroxypropoxy]-2,3-dihydro-1H-1,3-benzodiazol-2-one hydrochloride | CGP 12177 | CGP-12177 | CGP12177 | [3H]CGP 12177
Typeradiolabeled ligand
Emp. Form.C14H21N3O3
Mol. Mass.279.3348
SMILESCC(C)(C)NCC(O)COc1cccc2[nH]c(=O)[nH]c12
Structure