Ki Summary BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetHIV-1 Protease
LigandBDBM557
Substrate/CompetitorPeptide Substrate
Meas. Tech.Protease Inhibition Assay
pH5±n/a
Temperature295.15±n/a K
Ki 0.018±n/a nM
Citation Thaisrivongs, SSkulnick, HITurner, SRStrohbach, JWTommasi, RAJohnson, PDAristoff, PAJudge, TMGammill, RBMorris, JKRomines, KRChrusciel, RAHinshaw, RRChong, KTTarpley, WGPoppe, SMSlade, DELynn, JCHorng, MMTomich, PKSeest, EPDolak, LAHowe, WJHoward, GMWatenpaugh, KD Structure-based design of HIV protease inhibitors: sulfonamide-containing 5,6-dihydro-4-hydroxy-2-pyrones as non-peptidic inhibitors. J Med Chem39:4349-53 (1996) [PubMed]  Article
More Info.:Get all data from this article,   Solution Info,  Assay Method
 
HIV-1 Protease
Name:HIV-1 Protease
Synonyms:n/a
Type:Tandem linked enzyme construct
Mol. Mass.:n/a
Description:n/a
Components:This complex has 2 components.
Component 1
Name:Human immunodeficiency virus type 1 protease
Synonyms:Pol polyprotein
Type:Enzyme Subunit
Mol. Mass.:10781.16
Organism:Human immunodeficiency virus type 1
Description:n/a
Residue:99
Sequence:
PQVTLWQRPLVTIKIGGQLKEALLDTGADDTVLEEMSLPGRWKPKMIGGIGGFIKVRQYD
QILIEICGHKAIGTVLVGPTPVNIIGRNLLTQIGCTLNF
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
Component 2
Name:Human immunodeficiency virus type 1 protease
Synonyms:Pol polyprotein
Type:Enzyme Subunit
Mol. Mass.:10781.16
Organism:Human immunodeficiency virus type 1
Description:n/a
Residue:99
Sequence:
PQVTLWQRPLVTIKIGGQLKEALLDTGADDTVLEEMSLPGRWKPKMIGGIGGFIKVRQYD
QILIEICGHKAIGTVLVGPTPVNIIGRNLLTQIGCTLNF
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM557
NameBDBM557
Synonyms:N-{3-[(1R)-1-[(6S)-4-hydroxy-2-oxo-6-(2-phenylethyl)-6-propyl-5,6-dihydro-2H-pyran-3-yl]propyl]phenyl}-5-(trifluoromethyl)pyridine-2-sulfonamide | Sulfonamide-Containing 5,6-Dihydro-4-hydroxy-2-pyrones | Tipranavir analog 14
TypeSmall organic molecule
Emp. Form.n/a
Mol. Mass.n/a
SMILESn/a
Structure 
Peptide Substrate
Name:Peptide Substrate
Synonyms:n/a
Type:Peptide
Mol. Mass.:1447.64
Organism:n/a
Description:The peptide was derivatized with biotin and fluorescein isothiocyanate at the amino and carboxy termini.
Residue:12
Sequence:
RVSQNYPIVQNK