Ki Summary BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetBcl-2-like protein 1
LigandBDBM31389
Substrate/CompetitorFl-Bak peptide
Meas. Tech.Fluorescence Polarization Assay
pH7.4±n/a
Temperature298.15±n/a K
CommentsNo affinity.
Citation Yin, HLee, GISedey, KARodriguez, JMWang, HGSebti, SMHamilton, AD Terephthalamide derivatives as mimetics of helical peptides: disruption of the Bcl-x(L)/Bak interaction. J Am Chem Soc127:5463-8 (2005) [PubMed]  Article
More Info.:Get all data from this article,  Inhibition_Run data,   Solution Info,  Assay Method
 
Bcl-2-like protein 1
Name:Bcl-2-like protein 1
Synonyms:Anti-apoptotic Bcl-2 protein | Apoptosis Regulator Bcl-xL | Apoptosis regulator Bcl-X | BCL2-like 1 isoform 1 | Bcl-2-like protein 1 (Bcl-XL) | Bcl-X | Bcl2-L-1 | Bcl2-antagonist of cell death (BAD)
Type:Mitochondrion membrane; Single-pass membrane protein
Mol. Mass.:26039.60
Organism:Homo sapiens (Human)
Description:n/a
Residue:233
Sequence:
MSQSNRELVVDFLSYKLSQKGYSWSQFSDVEENRTEAPEGTESEMETPSAINGNPSWHLA
DSPAVNGATGHSSSLDAREVIPMAAVKQALREAGDEFELRYRRAFSDLTSQLHITPGTAY
QSFEQVVNELFRDGVNWGRIVAFFSFGGALCVESVDKEMQVLVSRIAAWMATYLNDHLEP
WIQENGGWDTFVELYGNNAAAESRKGQERFNRWFLTGMTVAGVVLLGSLFSRK
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM31389
NameBDBM31389
Synonyms:CHEMBL29180 | terephthalamide scaffold, 36
TypeSmall organic molecule
Emp. Form.C13H16N2O4
Mol. Mass.264.2771
SMILESCOC(=O)CNC(=O)c1ccc(cc1)C(=O)N(C)C
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least:
Fl-Bak peptide
Name:Fl-Bak peptide
Synonyms:n/a
Type:Fluoroscein-labled peptide
Mol. Mass.:2079.80
Organism:n/a
Description:The N-terminus of fluoroscein-labled Bak peptide was capped with the fluorophore and the C-terminus was amidated.
Residue:19
Sequence:
GQVGRQLAIIGDDINR-CONH2