Ki Summary BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetVasopressin V2 receptor (V2)
LigandBDBM35706
Substrate/CompetitorBDBM35667
Meas. Tech.Binding Affinity Assay (Ki) and cAMP Accumulation Activity Assay (EC50)
pH7.4±n/a
Temperature296.15±n/a K
Ki 11±n/a nM
EC50 646±n/a nM
CommentsAMP accumulation max activity = 62.8 %.
Citation Tsukamoto, IKoshio, HAkamatsu, SKuramochi, TSaitoh, CYatsu, TYanai-Inamura, HKitada, CYamamoto, ESakamoto, STsukamoto, S Preparation of (4,4-difluoro-1,2,3,4-tetrahydro-5H-1-benzazepin-5-ylidene)acetamide derivatives as novel arginine vasopressin V(2) receptor agonists. Bioorg Med Chem16:9524-35 (2008) [PubMed]  Article
More Info.:Get all data from this article,   Solution Info,  Assay Method
 
Vasopressin V2 receptor (V2)
Name:Vasopressin receptor
Synonyms:AVPR V2 | AVPR2 | Antidiuretic hormone receptor | Renal-type arginine vasopressin receptor | VASOPRESSIN V2 | Vasopressin V2 receptor
Type:Receptor
Mol. Mass.:40295.28
Organism:Homo sapiens (Human)
Description:P30518
Residue:371
Sequence:
MLMASTTSAVPGHPSLPSLPSNSSQERPLDTRDPLLARAELALLSIVFVAVALSNGLVLA
ALARRGRRGHWAPIHVFIGHLCLADLAVALFQVLPQLAWKATDRFRGPDALCRAVKYLQM
VGMYASSYMILAMTLDRHRAICRPMLAYRHGSGAHWNRPVLVAWAFSLLLSLPQLFIFAQ
RNVEGGSGVTDCWACFAEPWGRRTYVTWIALMVFVAPTLGIAACQVLIFREIHASLVPGP
SERPGGRRRGRRTGSPGEGAHVSAAVAKTVRMTLVIVVVYVLCWAPFFLVQLWAAWDPEA
PLEGAPFVLLMLLASLNSCTNPWIYASFSSSVSSELRSLLCCARGRTPPSLGPQDESCTT
ASSSLAKDTSS
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM35706
NameBDBM35706
Synonyms:5H-1-benzazepin-5-ylidene acetamide, 10m
TypeSmall organic molecule
Emp. Form.C31H31ClF2N4O2
Mol. Mass.565.053
SMILESFC1(F)CCN(C(=O)c2ccc(cc2Cl)N2CCCCCC2)c2ccccc2\C1=C\C(=O)NCc1ccccn1
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least:
BDBM35667
NameBDBM35667
Synonyms:AVP | CHEMBL373742 | US10131692, 44 (AVP) | [3H]Arginine vasopressin | [3H]Argipressin tannate | [3H]vasopressin
Typeradiolabeled ligand
Emp. Form.C46H65N15O12S2
Mol. Mass.1084.232
SMILES[#7]-[#6@H]-1-[#6]-[#16]-[#16]-[#6]-[#6@H](-[#7]-[#6](=O)-[#6@H](-[#6]-[#6](-[#7])=O)-[#7]-[#6](=O)-[#6@H](-[#6]-[#6]-[#6](-[#7])=O)-[#7]-[#6](=O)-[#6@H](-[#6]-c2ccccc2)-[#7]-[#6](=O)-[#6@H](-[#6]-c2ccc(-[#8])cc2)-[#7]-[#6]-1=O)-[#6](=O)-[#7]-1-[#6]-[#6]-[#6]-[#6@H]-1-[#6](=O)-[#7]-[#6@@H](-[#6]-[#6]-[#6]\[#7]=[#6](\[#7])-[#7])-[#6](=O)-[#7]-[#6]-[#6](-[#7])=O
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least: