Ki Summary BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetKaposi's sarcoma-associated herpesvirus (KSHV)
LigandBDBM36461
Substrate/Competitorn/a
Meas. Tech.KSHV Pr Inhibition Assay
pH8±0
Temperature303.15±0 K
IC50 16.4±0.7 nM
Citation Shahian, TLee, GMLazic, AArnold, LAVelusamy, PRoels, CMGuy, RKCraik, CS Inhibition of a viral enzyme by a small-molecule dimer disruptor. Nat Chem Biol5:640-6 (2009) [PubMed]  Article
More Info.:Get all data from this article,   Solution Info,  Assay Method
 
Kaposi's sarcoma-associated herpesvirus (KSHV)
Name:Kaposi's sarcoma-associated herpesvirus (KSHV)
Synonyms:n/a
Type:Enzyme
Mol. Mass.:28080.00
Organism:Human herpesvirus 8 (HHV-8) (Kaposi's sarcoma-associated herpesvirus)
Description:Q98147
Residue:257
Sequence:
MATANNPPSGLLDPTLCEDRIFYNILEIEPRFLTSDSVFGTFQQSLTSHMRKLLGTWMFS
VCQEYNLEPNVVALALNLLDRLLLIKQVSKEHFQKTGSACLLVASKLRSLTPISTSSLCY
AAADSFSRQELIDQEKELLEKLAWRTEAVLATDVTSFLLLKLVGGSQHLDFWHHEVNTLI
TKALVDPKTGSLPASIISAAGCALLVPANVIPQDTHSGGVVPQLASILGCDVSVLQAAVE
QILTSVSDFDLRILDSY
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM36461
NameBDBM36461
Synonyms:3-Benzyl-4-(3-(cyclohexylmethyl)-4-methoxybenzamido)benzoic acid, 3 | CID42628633
TypeSmall organic molecule
Emp. Form.C29H31NO4
Mol. Mass.457.5607
SMILESCOc1ccc(cc1CC1CCCCC1)C(=O)Nc1ccc(cc1Cc1ccccc1)C(O)=O
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least:
n/a