BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetSphingosine 1-phosphate receptor 1
LigandBDBM37112
Substrate/Competitorn/a
Meas. Tech.Dose Response Assays for S1P1 Agonists and Agonism Potentiators - Agonist Assay 60K MLSMR
EC50>30000±n/a nM
Citation PubChem, PC Dose Response Assays for S1P1 Agonists and Agonism Potentiators - Agonist Assay 60K MLSMR PubChem Bioassay(2007)[AID]  Article
More Info.:Get all data from this article,   Solution Info,  Assay Method
 
Sphingosine 1-phosphate receptor 1
Name:Sphingosine 1-phosphate receptor 1
Synonyms:CHEDG1 | EDG1 | Endothelial differentiation G-protein coupled receptor 1 | S1P receptor | S1P1 | S1PR1 | Sphingosine 1-phosphate receptor 1 (S1PR1) | Sphingosine 1-phosphate receptor Edg-1
Type:Enzyme
Mol. Mass.:42836.02
Organism:Homo sapiens (Human)
Description:P21453
Residue:382
Sequence:
MGPTSVPLVKAHRSSVSDYVNYDIIVRHYNYTGKLNISADKENSIKLTSVVFILICCFII
LENIFVLLTIWKTKKFHRPMYYFIGNLALSDLLAGVAYTANLLLSGATTYKLTPAQWFLR
EGSMFVALSASVFSLLAIAIERYITMLKMKLHNGSNNFRLFLLISACWVISLILGGLPIM
GWNCISALSSCSTVLPLYHKHYILFCTTVFTLLLLSIVILYCRIYSLVRTRSRRLTFRKN
ISKASRSSEKSLALLKTVIIVLSVFIACWAPLFILLLLDVGCKVKTCDILFRAEYFLVLA
VLNSGTNPIIYTLTNKEMRRAFIRIMSCCKCPSGDSAGKFKRPIIAGMEFSRSKSDNSSH
PQKDEGDNPETIMSSGNVNSSS
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM37112
NameBDBM37112
Synonyms:MLS000099936 | N-(2-cyclohexyl-1,3-diketo-isoindolin-5-yl)propionamide | N-(2-cyclohexyl-1,3-dioxo-2,3-dihydro-1H-isoindol-5-yl)propanamide | N-(2-cyclohexyl-1,3-dioxo-5-isoindolyl)propanamide | N-(2-cyclohexyl-1,3-dioxoisoindol-5-yl)propanamide | N-[2-cyclohexyl-1,3-bis(oxidanylidene)isoindol-5-yl]propanamide | SMR000081105 | cid_2227998
TypeSmall organic molecule
Emp. Form.C17H20N2O3
Mol. Mass.300.3523
SMILESCCC(=O)Nc1ccc2C(=O)N(C3CCCCC3)C(=O)c2c1
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least:
n/a