BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetAlkaline phosphatase, tissue-nonspecific isozyme
LigandBDBM51399
Substrate/Competitorn/a
Meas. Tech.SAR assay for compounds activating TNAP in the presence of 100 mM DEA performed in a luminescence assay
EC50 7330±n/a nM
Citation PubChem, PC SAR assay for compounds activating TNAP in the presence of 100 mM DEA performed in a luminescence assay PubChem Bioassay(2009)[AID]
More Info.:Get all data from this article,   Solution Info,  Assay Method
 
Alkaline phosphatase, tissue-nonspecific isozyme
Name:Alkaline phosphatase, tissue-nonspecific isozyme
Synonyms:tissue-nonspecific alkaline phosphatase precursor
Type:PROTEIN
Mol. Mass.:57306.17
Organism:Homo sapiens
Description:ChEMBL_1448917
Residue:524
Sequence:
MISPFLVLAIGTCLTNSLVPEKEKDPKYWRDQAQETLKYALELQKLNTNVAKNVIMFLGD
GMGVSTVTAARILKGQLHHNPGEETRLEMDKFPFVALSKTYNTNAQVPDSAGTATAYLCG
VKANEGTVGVSAATERSRCNTTQGNEVTSILRWAKDAGKSVGIVTTTRVNHATPSAAYAH
SADRDWYSDNEMPPEALSQGCKDIAYQLMHNIRDIDVIMGGGRKYMYPKNKTDVEYESDE
KARGTRLDGLDLVDTWKSFKPRYKHSHFIWNRTELLTLDPHNVDYLLGLFEPGDMQYELN
RNNVTDPSLSEMVVVAIQILRKNPKGFFLLVEGGRIDHGHHEGKAKQALHEAVEMDRAIG
QAGSLTSSEDTLTVVTADHSHVFTFGGYTPRGNSIFGLAPMLSDTDKKPFTAILYGNGPG
YKVVGGERENVSMVDYAHNNYQAQSAVPLRHETHGGEDVAVFSKGPMAHLLHGVHEQNYV
PHVMAYAACIGANLGHCAPASSAGSLAAGPLLLALALYPLSVLF
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM51399
NameBDBM51399
Synonyms:2-cyclohexyl-N-(1H-1,2,4-triazol-5-yl)acetamide | 2-cyclohexyl-N-(1H-1,2,4-triazol-5-yl)ethanamide | MLS-0072999.0001 | cid_704227
TypeSmall organic molecule
Emp. Form.C10H16N4O
Mol. Mass.208.2602
SMILESO=C(CC1CCCCC1)Nc1nnc[nH]1
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least:
n/a