BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetRecName: Full=Zinc finger protein mex-5
LigandBDBM52592
Substrate/Competitorn/a
Meas. Tech.Fluorescent Polarization Homogeneous Dose Response HTS to Indentify Inhibitors of Mex-5 Binding to TCR-2
EC50 300000±n/a nM
Citation PubChem, PC Fluorescent Polarization Homogeneous Dose Response HTS to Indentify Inhibitors of Mex-5 Binding to TCR-2 PubChem Bioassay(2009)[AID]
More Info.:Get all data from this article,   Solution Info,  Assay Method
 
RecName: Full=Zinc finger protein mex-5
Name:RecName: Full=Zinc finger protein mex-5
Synonyms:n/a
Type:Enzyme Catalytic Domain
Mol. Mass.:52832.78
Organism:Caenorhabditis elegans
Description:gi_55976631
Residue:468
Sequence:
MKAASNSVSSAGGSVSPTTTQPPLPPGQSSHPQIYDQQMQYYFAAAMPNQPMATYAAQNG
SSQQYAPAAPYYQDANGQYVQVPANGSMAPQQHMMVSGQPYLYMAQPQQGAQQVMQSGQP
QLIYYQQSMAPQAAPMYFHPMQAAPMLPEQMGVMPHTQPAIPPQQQPRQVGVEISSTRTA
PLTSSTPLPTSLEYETVQRDNRNRNIQFRYHRVMEHDELPIDEISKITLDNHNDDTMSAE
KENHFHEHRGEKFGRRGFPIPETDSQQPPNYKTRLCMMHASGIKPCDMGARCKFAHGLKE
LRATDAPARYPNNKYKTKLCKNFARGGTGFCPYGLRCEFVHPTDKEFQNIPPYQRMSHDD
QDYDQDVIPEDYVVARHQPRFMRTGGRATTPTKVMLKHRNVAGSMMCLSNAGRDLQAGGD
YNQPESNEDDLPPHLRRNRRENPPMNKRRTSLSTKWTSEENLGLRGHY
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM52592
NameBDBM52592
Synonyms:4-(3-{[1-(2-furylmethyl)-2,4,6-trioxotetrahydro-5(2H)-pyrimidinylidene]methyl}-2,5-dimethyl-1H-pyrrol-1-yl)benzoic acid | 4-[3-[(Z)-[1-(2-furanylmethyl)-2,4,6-trioxo-1,3-diazinan-5-ylidene]methyl]-2,5-dimethyl-1-pyrrolyl]benzoic acid | 4-[3-[(Z)-[1-(2-furfuryl)-2,4,6-triketo-hexahydropyrimidin-5-ylidene]methyl]-2,5-dimethyl-pyrrol-1-yl]benzoic acid | 4-[3-[(Z)-[1-(furan-2-ylmethyl)-2,4,6-trioxo-1,3-diazinan-5-ylidene]methyl]-2,5-dimethylpyrrol-1-yl]benzoic acid | 4-[3-[(Z)-[1-(furan-2-ylmethyl)-2,4,6-tris(oxidanylidene)-1,3-diazinan-5-ylidene]methyl]-2,5-dimethyl-pyrrol-1-yl]benzoic acid | MLS000676714 | SMR000298369 | cid_1349496
TypeSmall organic molecule
Emp. Form.C23H19N3O6
Mol. Mass.433.4135
SMILESCc1cc(\C=C2\C(=O)NC(=O)N(Cc3ccco3)C2=O)c(C)n1-c1ccc(cc1)C(O)=O
Structure
n/a