BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetNucleotide-binding oligomerization domain-containing protein 1
LigandBDBM54384
Substrate/Competitorn/a
Meas. Tech.uHTS luminescence assay for the identification of compounds that inhibit NOD1
EC50 790±n/a nM
Citation PubChem, PC uHTS luminescence assay for the identification of compounds that inhibit NOD1 PubChem Bioassay(2010)[AID]
More Info.:Get all data from this article,   Solution Info,  Assay Method
 
Nucleotide-binding oligomerization domain-containing protein 1
Name:Nucleotide-binding oligomerization domain-containing protein 1
Synonyms:nucleotide-binding oligomerization domain containing 1
Type:Enzyme Catalytic Domain
Mol. Mass.:107699.03
Organism:Homo sapiens (Human)
Description:gi_5174617
Residue:953
Sequence:
MEEQGHSEMEIIPSESHPHIQLLKSNRELLVTHIRNTQCLVDNLLKNDYFSAEDAEIVCA
CPTQPDKVRKILDLVQSKGEEVSEFFLYLLQQLADAYVDLRPWLLEIGFSPSLLTQSKVV
VNTDPVSRYTQQLRHHLGRDSKFVLCYAQKEELLLEEIYMDTIMELVGFSNESLGSLNSL
ACLLDHTTGILNEQGETIFILGDAGVGKSMLLQRLQSLWATGRLDAGVKFFFHFRCRMFS
CFKESDRLCLQDLLFKHYCYPERDPEEVFAFLLRFPHVALFTFDGLDELHSDLDLSRVPD
SSCPWEPAHPLVLLANLLSGKLLKGASKLLTARTGIEVPRQFLRKKVLLRGFSPSHLRAY
ARRMFPERALQDRLLSQLEANPNLCSLCSVPLFCWIIFRCFQHFRAAFEGSPQLPDCTMT
LTDVFLLVTEVHLNRMQPSSLVQRNTRSPVETLHAGRDTLCSLGQVAHRGMEKSLFVFTQ
EEVQASGLQERDMQLGFLRALPELGPGGDQQSYEFFHLTLQAFFTAFFLVLDDRVGTQEL
LRFFQEWMPPAGAATTSCYPPFLPFQCLQGSGPAREDLFKNKDHFQFTNLFLCGLLSKAK
QKLLRHLVPAAALRRKRKALWAHLFSSLRGYLKSLPRVQVESFNQVQAMPTFIWMLRCIY
ETQSQKVGQLAARGICANYLKLTYCNACSADCSALSFVLHHFPKRLALDLDNNNLNDYGV
RELQPCFSRLTVLRLSVNQITDGGVKVLSEELTKYKIVTYLGLYNNQITDVGARYVTKIL
DECKGLTHLKLGKNKITSEGGKYLALAVKNSKSISEVGMWGNQVGDEGAKAFAEALRNHP
SLTTLSLASNGISTEGGKSLARALQQNTSLEILWLTQNELNDEVAESLAEMLKVNQTLKH
LWLIQNQITAKGTAQLADALQSNTGITEICLNGNLIKPEEAKVYEDEKRIICF
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM54384
NameBDBM54384
Synonyms:MLS000757219 | N-(4-bromanylnaphthalen-1-yl)-1-oxidanyl-naphthalene-2-carboxamide | N-(4-bromo-1-naphthalenyl)-1-hydroxy-2-naphthalenecarboxamide | N-(4-bromo-1-naphthyl)-1-hydroxy-2-naphthamide | N-(4-bromonaphthalen-1-yl)-1-hydroxynaphthalene-2-carboxamide | SMR000529047 | cid_353380
TypeSmall organic molecule
Emp. Form.C21H14BrNO2
Mol. Mass.392.245
SMILESOc1c(ccc2ccccc12)C(=O)Nc1ccc(Br)c2ccccc12
Structure
n/a