BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetG-protein coupled receptor 55
LigandBDBM61034
Substrate/Competitorn/a
Meas. Tech.Image-based HTS for Selective Agonists of GPR55
EC50 1030.395±n/a nM
Citation PubChem, PC Image-based HTS for Selective Agonists of GPR55 PubChem Bioassay(2010)[AID]
More Info.:Get all data from this article,   Solution Info,  Assay Method
 
G-protein coupled receptor 55
Name:G-protein coupled receptor 55
Synonyms:G protein-coupled receptor 55
Type:PROTEIN
Mol. Mass.:36649.72
Organism:Homo sapiens (Human)
Description:ChEMBL_1292265
Residue:319
Sequence:
MSQQNTSGDCLFDGVNELMKTLQFAVHIPTFVLGLLLNLLAIHGFSTFLKNRWPDYAATS
IYMINLAVFDLLLVLSLPFKMVLSQVQSPFPSLCTLVECLYFVSMYGSVFTICFISMDRF
LAIRYPLLVSHLRSPRKIFGICCTIWVLVWTGSIPIYSFHGKVEKYMCFHNMSDDTWSAK
VFFPLEVFGFLLPMGIMGFCCSRSIHILLGRRDHTQDWVQQKACIYSIAASLAVFVVSFL
PVHLGFFLQFLVRNSFIVECRAKQSISFFLQLSMCFSNVNCCLDVFCYYFVIKEFRMNIR
AHRPSRVQLVLQDTTISRG
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM61034
NameBDBM61034
Synonyms:2-(8-Methoxy-4-methyl-[1,2,4]triazolo[4,3-a]quinolin-1-ylsulfanyl)-N-(4-phenyl-thiazol-2-yl)-acetamide | 2-[(8-methoxy-4-methyl-[1,2,4]triazolo[4,3-a]quinolin-1-yl)sulfanyl]-N-(4-phenyl-1,3-thiazol-2-yl)acetamide | 2-[(8-methoxy-4-methyl-[1,2,4]triazolo[4,3-a]quinolin-1-yl)sulfanyl]-N-(4-phenyl-1,3-thiazol-2-yl)ethanamide | 2-[(8-methoxy-4-methyl-[1,2,4]triazolo[4,3-a]quinolin-1-yl)thio]-N-(4-phenyl-2-thiazolyl)acetamide | 2-[(8-methoxy-4-methyl-[1,2,4]triazolo[4,3-a]quinolin-1-yl)thio]-N-(4-phenylthiazol-2-yl)acetamide | MLS000549783 | SMR000172758 | cid_1172037
TypeSmall organic molecule
Emp. Form.C23H19N5O2S2
Mol. Mass.461.559
SMILESCOc1ccc2cc(C)c3nnc(SCC(=O)Nc4nc(cs4)-c4ccccc4)n3c2c1
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least:
n/a