BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetG-protein coupled receptor 35
LigandBDBM68295
Substrate/Competitorn/a
Meas. Tech.SAR analysis of Agonists of the GPR35 Receptor using an Image-Based Assay - Set 3
EC50>32000±n/a nM
Citation PubChem, PC SAR analysis of Agonists of the GPR35 Receptor using an Image-Based Assay - Set 3 PubChem Bioassay(2010)[AID]
More Info.:Get all data from this article,   Solution Info,  Assay Method
 
G-protein coupled receptor 35
Name:G-protein coupled receptor 35
Synonyms:G protein-coupled receptor 35
Type:Enzyme Catalytic Domain
Mol. Mass.:34085.57
Organism:Homo sapiens (Human)
Description:gi_33695097
Residue:309
Sequence:
MNGTYNTCGSSDLTWPPAIKLGFYAYLGVLLVLGLLLNSLALWVFCCRMQQWTETRIYMT
NLAVADLCLLCTLPFVLHSLRDTSDTPLCQLSQGIYLTNRYMSISLVTAIAVDRYVAVRH
PLRARGLRSPRQAAAVCAVLWVLVIGSLVARWLLGIQEGGFCFRSTRHNFNSMAFPLLGF
YLPLAVVVFCSLKVVTALAQRPPTDVGQAEATRKAARMVWANLLVFVVCFLPLHVGLTVR
LAVGWNACALLETIRRALYITSKLSDANCCLDAICYYYMAKEFQEASALAVAPSAKAHKS
QDSLCVTLA
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM68295
NameBDBM68295
Synonyms:MLS-0413566.0001 | N-(2-methoxy-5-morpholin-4-ylsulfonyl-phenyl)-1,3-benzodioxole-5-carboxamide | N-(2-methoxy-5-morpholin-4-ylsulfonylphenyl)-1,3-benzodioxole-5-carboxamide | N-(2-methoxy-5-morpholinosulfonyl-phenyl)-piperonylamide | N-[2-methoxy-5-(4-morpholinylsulfonyl)phenyl]-1,3-benzodioxole-5-carboxamide | cid_3921758
TypeSmall organic molecule
Emp. Form.C19H20N2O7S
Mol. Mass.420.436
SMILESCOc1ccc(cc1NC(=O)c1ccc2OCOc2c1)S(=O)(=O)N1CCOCC1
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least:
n/a