BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetCannabinoid receptor 2
LigandBDBM68306
Substrate/Competitorn/a
Meas. Tech.SAR analysis of agonists of the Cannabinoid Receptor 2 using an Image-Based Assay - Set 2
EC50>32000±n/a nM
Citation PubChem, PC SAR analysis of agonists of the Cannabinoid Receptor 2 using an Image-Based Assay - Set 2 PubChem Bioassay(2010)[AID]  Article
More Info.:Get all data from this article,   Solution Info,  Assay Method
 
Cannabinoid receptor 2
Name:Cannabinoid receptor 2
Synonyms:CANNABINOID CB2 | CB-2 | CB2 | CB2A | CB2B | CNR2 | CX5 | Cannabinoid CB2 receptor | Cannabinoid receptor 2 (CB2) | Cannabinoid receptor 2 (CB2R) | hCB2
Type:G Protein-Coupled Receptor (GPCR)
Mol. Mass.:39690.94
Organism:Homo sapiens (Human)
Description:P34972
Residue:360
Sequence:
MEECWVTEIANGSKDGLDSNPMKDYMILSGPQKTAVAVLCTLLGLLSALENVAVLYLILS
SHQLRRKPSYLFIGSLAGADFLASVVFACSFVNFHVFHGVDSKAVFLLKIGSVTMTFTAS
VGSLLLTAIDRYLCLRYPPSYKALLTRGRALVTLGIMWVLSALVSYLPLMGWTCCPRPCS
ELFPLIPNDYLLSWLLFIAFLFSGIIYTYGHVLWKAHQHVASLSGHQDRQVPGMARMRLD
VRLAKTLGLVLAVLLICWFPVLALMAHSLATTLSDQVKKAFAFCSMLCLINSMVNPVIYA
LRSGEIRSSAHHCLAHWKKCVRGLGSEAKEEAPRSSVTETEADGKITPWPDSRDLDLSDC
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM68306
NameBDBM68306
Synonyms:3-[4-(5-chloranyl-2-methyl-phenyl)piperazin-1-yl]carbonyl-N,N-dimethyl-4-pyrrolidin-1-yl-benzenesulfonamide | 3-[4-(5-chloro-2-methyl-phenyl)piperazine-1-carbonyl]-N,N-dimethyl-4-pyrrolidino-benzenesulfonamide | 3-[4-(5-chloro-2-methylphenyl)piperazine-1-carbonyl]-N,N-dimethyl-4-pyrrolidin-1-ylbenzenesulfonamide | 3-[[4-(5-chloro-2-methylphenyl)-1-piperazinyl]-oxomethyl]-N,N-dimethyl-4-(1-pyrrolidinyl)benzenesulfonamide | MLS-0435532.0001 | cid_16262621
TypeSmall organic molecule
Emp. Form.C24H31ClN4O3S
Mol. Mass.491.046
SMILESCN(C)S(=O)(=O)c1ccc(N2CCCC2)c(c1)C(=O)N1CCN(CC1)c1cc(Cl)ccc1C
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least:
n/a