BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetHematopoietic protein-tyrosine phosphatase (HEPTP)
LigandBDBM75990
Substrate/Competitorn/a
Meas. Tech.Dose Response confirmation of compounds that inhibit HePTP
IC50 5360±n/a nM
Citation PubChem, PC Dose Response confirmation of compounds that inhibit HePTP PubChem Bioassay(2010)[AID]
More Info.:Get all data from this article,   Solution Info,  Assay Method
 
Hematopoietic protein-tyrosine phosphatase (HEPTP)
Name:Hematopoietic protein-tyrosine phosphatase (HEPTP)
Synonyms:He-PTP | Hematopoietic protein-tyrosine phosphatase | Protein-tyrosine phosphatase LC-PTP | Tyrosine-protein phosphatase non-receptor type 7 | Tyrosine-protein phosphatase non-receptor type 7 (HEPTP)
Type:Protein
Mol. Mass.:40530.79
Organism:Homo sapiens (Human)
Description:P35236
Residue:360
Sequence:
MVQAHGGRSRAQPLTLSLGAAMTQPPPEKTPAKKHVRLQERRGSNVALMLDVRSLGAVEP
ICSVNTPREVTLHFLRTAGHPLTRWALQRQPPSPKQLEEEFLKIPSNFVSPEDLDIPGHA
SKDRYKTILPNPQSRVCLGRAQSQEDGDYINANYIRGYDGKEKVYIATQGPMPNTVSDFW
EMVWQEEVSLIVMLTQLREGKEKCVHYWPTEEETYGPFQIRIQDMKECPEYTVRQLTIQY
QEERRSVKHILFSAWPDHQTPESAGPLLRLVAEVEESPETAAHPGPIVVHCSAGIGRTGC
FIATRIGCQQLKARGEVDILGIVCQLRLDRGGMIQTAEQYQFLHHTLALYAGQLPEEPSP
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM75990
NameBDBM75990
Synonyms:MLS000765462 | N-(2-pyridin-3-yl-1,3-benzoxazol-5-yl)-2,3-dihydro-1,4-benzodioxine-6-carboxamide | N-[2-(3-pyridinyl)-1,3-benzoxazol-5-yl]-2,3-dihydro-1,4-benzodioxin-6-carboxamide | N-[2-(3-pyridyl)-1,3-benzoxazol-5-yl]-2,3-dihydro-1,4-benzodioxin-6-carboxamide | SMR000289567 | cid_1160074
TypeSmall organic molecule
Emp. Form.C21H15N3O4
Mol. Mass.373.3615
SMILESO=C(Nc1ccc2oc(nc2c1)-c1cccnc1)c1ccc2OCCOc2c1
Structure
n/a