BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
Targetubiquitin-conjugating enzyme E2 N
LigandBDBM79077
Substrate/Competitorn/a
Meas. Tech.Dose Response confirmation of uHTS for the identification of UBC13 Polyubiquitin Inhibitors via a TR-FRET Assay
IC50>20000±0 nM
Citation PubChem, PC Dose Response confirmation of uHTS for the identification of UBC13 Polyubiquitin Inhibitors via a TR-FRET Assay PubChem Bioassay(2011)[AID]
More Info.:Get all data from this article,   Solution Info,  Assay Method
 
ubiquitin-conjugating enzyme E2 N
Name:Ubiquitin-conjugating enzyme E2 N
Synonyms:n/a
Type:PROTEIN
Mol. Mass.:17137.61
Organism:Homo sapiens (Human)
Description:EBI_101440
Residue:152
Sequence:
MAGLPRRIIKETQRLLAEPVPGIKAEPDESNARYFHVVIAGPQDSPFEGGTFKLELFLPE
EYPMAAPKVRFMTKIYHPNVDKLGRICLDILKDKWSPALQIRTVLLSIQALLSAPNPDDP
LANDVAEQWKTNEAQAIETARAWTRLYAMNNI
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM79077
NameBDBM79077
Synonyms:4-Amino-isothiazole-3,5-dicarboxylic acid 3-amide 5-((4-fluoro-phenyl)-{(5-methyl-furan-2-yl)-[(tetrahydro-furan-2-ylmethyl)-carbamoyl]-methyl}-amide) | 4-amino-5-N-(4-fluorophenyl)-5-N-[1-(5-methylfuran-2-yl)-2-oxo-2-(oxolan-2-ylmethylamino)ethyl]-1,2-thiazole-3,5-dicarboxamide | 4-amino-N'-(4-fluorophenyl)-N'-[2-keto-1-(5-methyl-2-furyl)-2-(tetrahydrofurfurylamino)ethyl]isothiazole-3,5-dicarboxamide | 4-amino-N5-(4-fluorophenyl)-N5-[1-(5-methyl-2-furanyl)-2-oxo-2-(2-oxolanylmethylamino)ethyl]isothiazole-3,5-dicarboxamide | 4-azanyl-N5-(4-fluorophenyl)-N5-[1-(5-methylfuran-2-yl)-2-oxidanylidene-2-(oxolan-2-ylmethylamino)ethyl]-1,2-thiazole-3,5-dicarboxamide | MLS001216725 | SMR000599706 | cid_3174273
TypeSmall organic molecule
Emp. Form.C23H24FN5O5S
Mol. Mass.501.531
SMILESCc1ccc(o1)C(N(C(=O)c1snc(C(N)=O)c1N)c1ccc(F)cc1)C(=O)NCC1CCCO1
Structure
n/a