BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
Targetputative hexokinase HKDC1
LigandBDBM80786
Substrate/Competitorn/a
Meas. Tech.Dose Response confirmation of activators of hexokinase domain containing I (HKDC1)
EC50 35700±n/a nM
Citation PubChem, PC Dose Response confirmation of activators of hexokinase domain containing I (HKDC1) PubChem Bioassay(2011)[AID]
More Info.:Get all data from this article,   Solution Info,  Assay Method
 
putative hexokinase HKDC1
Name:putative hexokinase HKDC1
Synonyms:n/a
Type:Enzyme Catalytic Domain
Mol. Mass.:102520.24
Organism:Homo sapiens (Human)
Description:gi_156151420
Residue:917
Sequence:
MFAVHLMAFYFSKLKEDQIKKVDRFLYHMRLSDDTLLDIMRRFRAEMEKGLAKDTNPTAA
VKMLPTFVRAIPDGSENGEFLSLDLGGSKFRVLKVQVAEEGKRHVQMESQFYPTPNEIIR
GNGTELFEYVADCLADFMKTKDLKHKKLPLGLTFSFPCRQTKLEEGVLLSWTKKFKARGV
QDTDVVSRLTKAMRRHKDMDVDILALVNDTVGTMMTCAYDDPYCEVGVIIGTGTNACYME
DMSNIDLVEGDEGRMCINTEWGAFGDDGALEDIRTEFDRELDLGSLNPGKQLFEKMISGL
YLGELVRLILLKMAKAGLLFGGEKSSALHTKGKIETRHVAAMEKYKEGLANTREILVDLG
LEPSEADCIAVQHVCTIVSFRSANLCAAALAAILTRLRENKKVERLRTTVGMDGTLYKIH
PQYPKRLHKVVRKLVPSCDVRFLLSESGSTKGAAMVTAVASRVQAQRKQIDRVLALFQLT
REQLVDVQAKMRAELEYGLKKKSHGLATVRMLPTYVCGLPDGTEKGKFLALDLGGTNFRV
LLVKIRSGRRSVRMYNKIFAIPLEIMQGTGEELFDHIVQCIADFLDYMGLKGASLPLGFT
FSFPCRQMSIDKGTLIGWTKGFKATDCEGEDVVDMLREAIKRRNEFDLDIVAVVNDTVGT
MMTCGYEDPNCEIGLIAGTGSNMCYMEDMRNIEMVEGGEGKMCINTEWGGFGDNGCIDDI
RTRYDTEVDEGSLNPGKQRYEKMTSGMYLGEIVRQILIDLTKQGLLFRGQISERLRTRGI
FETKFLSQIESDRLALLQVRRILQQLGLDSTCEDSIVVKEVCGAVSRRAAQLCGAGLAAI
VEKRREDQGLEHLRITVGVDGTLYKLHPHFSRILQETVKELAPRCDVTFMLSEDGSGKGA
ALITAVAKRLQQAQKEN
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM80786
NameBDBM80786
Synonyms:5-(2,5-difluorophenyl)-N-(4-fluorophenyl)-6H-1,3,4-thiadiazin-2-amine | 5-[2,5-bis(fluoranyl)phenyl]-N-(4-fluorophenyl)-6H-1,3,4-thiadiazin-2-amine | MLS000390436 | SMR000255403 | [5-(2,5-difluorophenyl)-6H-1,3,4-thiadiazin-2-yl]-(4-fluorophenyl)amine | cid_8968424
TypeSmall organic molecule
Emp. Form.C15H10F3N3S
Mol. Mass.321.32
SMILESFc1ccc(NC2=NN=C(CS2)c2cc(F)ccc2F)cc1 |c:8,t:6|
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least:
n/a