BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
Targetputative hexokinase HKDC1
LigandBDBM80789
Substrate/Competitorn/a
Meas. Tech.Dose Response confirmation of activators of hexokinase domain containing I (HKDC1)
EC50>80000±n/a nM
Citation PubChem, PC Dose Response confirmation of activators of hexokinase domain containing I (HKDC1) PubChem Bioassay(2011)[AID]
More Info.:Get all data from this article,   Solution Info,  Assay Method
 
putative hexokinase HKDC1
Name:putative hexokinase HKDC1
Synonyms:n/a
Type:Enzyme Catalytic Domain
Mol. Mass.:102520.24
Organism:Homo sapiens (Human)
Description:gi_156151420
Residue:917
Sequence:
MFAVHLMAFYFSKLKEDQIKKVDRFLYHMRLSDDTLLDIMRRFRAEMEKGLAKDTNPTAA
VKMLPTFVRAIPDGSENGEFLSLDLGGSKFRVLKVQVAEEGKRHVQMESQFYPTPNEIIR
GNGTELFEYVADCLADFMKTKDLKHKKLPLGLTFSFPCRQTKLEEGVLLSWTKKFKARGV
QDTDVVSRLTKAMRRHKDMDVDILALVNDTVGTMMTCAYDDPYCEVGVIIGTGTNACYME
DMSNIDLVEGDEGRMCINTEWGAFGDDGALEDIRTEFDRELDLGSLNPGKQLFEKMISGL
YLGELVRLILLKMAKAGLLFGGEKSSALHTKGKIETRHVAAMEKYKEGLANTREILVDLG
LEPSEADCIAVQHVCTIVSFRSANLCAAALAAILTRLRENKKVERLRTTVGMDGTLYKIH
PQYPKRLHKVVRKLVPSCDVRFLLSESGSTKGAAMVTAVASRVQAQRKQIDRVLALFQLT
REQLVDVQAKMRAELEYGLKKKSHGLATVRMLPTYVCGLPDGTEKGKFLALDLGGTNFRV
LLVKIRSGRRSVRMYNKIFAIPLEIMQGTGEELFDHIVQCIADFLDYMGLKGASLPLGFT
FSFPCRQMSIDKGTLIGWTKGFKATDCEGEDVVDMLREAIKRRNEFDLDIVAVVNDTVGT
MMTCGYEDPNCEIGLIAGTGSNMCYMEDMRNIEMVEGGEGKMCINTEWGGFGDNGCIDDI
RTRYDTEVDEGSLNPGKQRYEKMTSGMYLGEIVRQILIDLTKQGLLFRGQISERLRTRGI
FETKFLSQIESDRLALLQVRRILQQLGLDSTCEDSIVVKEVCGAVSRRAAQLCGAGLAAI
VEKRREDQGLEHLRITVGVDGTLYKLHPHFSRILQETVKELAPRCDVTFMLSEDGSGKGA
ALITAVAKRLQQAQKEN
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM80789
NameBDBM80789
Synonyms:8-[(1-allyl-3-nitro-1H-1,2,4-triazol-5-yl)thio]quinoline | 8-[(2-allyl-5-nitro-1,2,4-triazol-3-yl)thio]quinoline | 8-[(5-nitro-2-prop-2-enyl-1,2,4-triazol-3-yl)sulfanyl]quinoline | 8-[(5-nitro-2-prop-2-enyl-1,2,4-triazol-3-yl)thio]quinoline | MLS000662750 | SMR000270197 | cid_805756
TypeSmall organic molecule
Emp. Form.C14H11N5O2S
Mol. Mass.313.334
SMILES[O-][N+](=O)c1nc(Sc2cccc3cccnc23)n(CC=C)n1
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least:
n/a