BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetHexokinase type I
LigandBDBM66066
Substrate/Competitorn/a
Meas. Tech.Dose Response confirmation of activators of hexokinase domain containing I (HKDC1) in the hexokinase 1 selectivity assay
EC50>80000±n/a nM
Citation PubChem, PC Dose Response confirmation of activators of hexokinase domain containing I (HKDC1) in the hexokinase 1 selectivity assay PubChem Bioassay(2011)[AID]
More Info.:Get all data from this article,   Solution Info,  Assay Method
 
Hexokinase type I
Name:Hexokinase type I
Synonyms:Brain form hexokinase | HK I | Hexokinase-1 | hexokinase-1 isoform HKI
Type:PROTEIN
Mol. Mass.:102488.34
Organism:Homo sapiens (Human)
Description:EBI_11382
Residue:917
Sequence:
MIAAQLLAYYFTELKDDQVKKIDKYLYAMRLSDETLIDIMTRFRKEMKNGLSRDFNPTAT
VKMLPTFVRSIPDGSEKGDFIALDLGGSSFRILRVQVNHEKNQNVHMESEVYDTPENIVH
GSGSQLFDHVAECLGDFMEKRKIKDKKLPVGFTFSFPCQQSKIDEAILITWTKRFKASGV
EGADVVKLLNKAIKKRGDYDANIVAVVNDTVGTMMTCGYDDQHCEVGLIIGTGTNACYME
ELRHIDLVEGDEGRMCINTEWGAFGDDGSLEDIRTEFDREIDRGSLNPGKQLFEKMVSGM
YLGELVRLILVKMAKEGLLFEGRITPELLTRGKFNTSDVSAIEKNKEGLHNAKEILTRLG
VEPSDDDCVSVQHVCTIVSFRSANLVAATLGAILNRLRDNKGTPRLRTTVGVDGSLYKTH
PQYSRRFHKTLRRLVPDSDVRFLLSESGSGKGAAMVTAVAYRLAEQHRQIEETLAHFHLT
KDMLLEVKKRMRAEMELGLRKQTHNNAVVKMLPSFVRRTPDGTENGDFLALDLGGTNFRV
LLVKIRSGKKRTVEMHNKIYAIPIEIMQGTGEELFDHIVSCISDFLDYMGIKGPRMPLGF
TFSFPCQQTSLDAGILITWTKGFKATDCVGHDVVTLLRDAIKRREEFDLDVVAVVNDTVG
TMMTCAYEEPTCEVGLIVGTGSNACYMEEMKNVEMVEGDQGQMCINMEWGAFGDNGCLDD
IRTHYDRLVDEYSLNAGKQRYEKMISGMYLGEIVRNILIDFTKKGFLFRGQISETLKTRG
IFETKFLSQIESDRLALLQVRAILQQLGLNSTCDDSILVKTVCGVVSRRAAQLCGAGMAA
VVDKIRENRGLDRLNVTVGVDGTLYKLHPHFSRIMHQTVKELSPKCNVSFLLSEDGSGKG
AALITAVGVRLRTEASS
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM66066
NameBDBM66066
Synonyms:(E)-3-(4-Methoxy-phenyl)-N-[N'-(pyrazine-2-carbonyl)-hydrazinocarbothioyl]-acrylamide | (E)-3-(4-methoxyphenyl)-N-[(pyrazin-2-ylcarbonylamino)carbamothioyl]prop-2-enamide | (E)-3-(4-methoxyphenyl)-N-[(pyrazine-2-carbonylamino)carbamothioyl]prop-2-enamide | (E)-3-(4-methoxyphenyl)-N-[(pyrazinoylamino)thiocarbamoyl]acrylamide | (E)-3-(4-methoxyphenyl)-N-[[[oxo(2-pyrazinyl)methyl]hydrazo]-sulfanylidenemethyl]-2-propenamide | MLS000769398 | SMR000434132 | cid_1874139
TypeSmall organic molecule
Emp. Form.C16H15N5O3S
Mol. Mass.357.387
SMILESCOc1ccc(\C=C\C(=O)NC(=S)NNC(=O)c2cnccn2)cc1
Structure
n/a