Ki Summary BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetTyrosine-protein kinase CSK
LigandBDBM81376
Substrate/Competitorn/a
Meas. Tech.In Vitro Activity Assay
pH7.5±0
IC50 140±9 nM
Citation Ranjitkar, PBrock, AMMaly, DJ Affinity reagents that target a specific inactive form of protein kinases. Chem Biol17:195-206 (2010) [PubMed]  Article
More Info.:Get all data from this article,   Solution Info,  Assay Method
 
Tyrosine-protein kinase CSK
Name:Tyrosine-protein kinase CSK
Synonyms:C-SRC kinase | C-src tyrosine kinase | CSK | Protein-tyrosine kinase CYL | Tyrosine Kinase CSK
Type:Tyrosine-protein kinase
Mol. Mass.:50707.30
Organism:Homo sapiens (human)
Description:n/a
Residue:450
Sequence:
MSAIQAAWPSGTECIAKYNFHGTAEQDLPFCKGDVLTIVAVTKDPNWYKAKNKVGREGII
PANYVQKREGVKAGTKLSLMPWFHGKITREQAERLLYPPETGLFLVRESTNYPGDYTLCV
SCDGKVEHYRIMYHASKLSIDEEVYFENLMQLVEHYTSDADGLCTRLIKPKVMEGTVAAQ
DEFYRSGWALNMKELKLLQTIGKGEFGDVMLGDYRGNKVAVKCIKNDATAQAFLAEASVM
TQLRHSNLVQLLGVIVEEKGGLYIVTEYMAKGSLVDYLRSRGRSVLGGDCLLKFSLDVCE
AMEYLEGNNFVHRDLAARNVLVSEDNVAKVSDFGLTKEASSTQDTGKLPVKWTAPEALRE
KKFSTKSDVWSFGILLWEIYSFGRVPYPRIPLKDVVPRVEKGYKMDAPDGCPPAVYEVMK
NCWHLDAAMRPSFLQLREQLEHIKTHELHL
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM81376
NameBDBM81376
Synonyms:Amine compound, 13a
TypeSmall organic molecule
Emp. Form.C42H47F3N8O7
Mol. Mass.832.8672
SMILESCc1ccc(NC(=O)c2cccc(c2)C(F)(F)F)cc1Nc1ncccc1-c1cc(Nc2ccc(OCCNC(=O)COCCOCCOCCOCCN)cc2)ncn1
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least:
n/a