Ki Summary BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetDRD1
LigandBDBM81195
Substrate/Competitorn/a
Ki 11±n/a nM
CommentsPDSP_239
Citation Burt, DRCreese, ISnyder, SH Properties of [3H]haloperidol and [3H]dopamine binding associated with dopamine receptors in calf brain membranes. Mol Pharmacol12:800-12 (1976) [PubMed]
More Info.:Get all data from this article
 
DRD1
Name:Dopamine receptor
Synonyms:D(1A) dopamine receptor | DOPAMINE D1
Type:Enzyme Catalytic Domain
Mol. Mass.:49330.65
Organism:BOVINE
Description:DOPAMINE D1 DRD1 BOVINE::Q95136
Residue:446
Sequence:
MRTLNTSTMEGTGLVAERDFSFRILTACFLSLLILSTLLGNTLVCAAVIRFRHLRSKVTN
FFVISLAVSDLLVAVLVMPWKAVAEIAGFWPFGSFCNIWVAFDIMCSTASILNLCVISVD
RYWAISSPFRYERKMTPKAAFILISVAWTLSVLISFIPVQLSWHKAKPTGPSEGNATSLG
KTINNCDSSLSRTYAISSSLISFYIPVAIMIVTYTRIYRIAQKQIRRISALERAAVHAKN
CQTTTGNGNPMECSQPESSFKMSFKRETKVLKTLSVIMGVFVCCWLPFFILNCMVPFCGS
GETKPFCIDSITFDVFVWFGWANSSLNPIIYAFNADFRKAFSTLLGCYRLCPTTNNAIET
VSINNNGAVVFSSHHEPRGSISKDCNVVYLIPHAVGSSEGLKKEEAVGIAKPLEKLSPAL
SVILDYDTDVSLEKIQPITQNGQHPT
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM81195
NameBDBM81195
Synonyms:(+/-)-2-Amino-6,7-dihydroxy-1,2,3,4-tetrahydronaphthalene hydrobromide | 2-aminotetralin-6,7-diol;hydrobromide | 6-Amino-5,6,7,8-tetrahydro-naphthalene-2,3-diol | 6-amino-5,6,7,8-tetrahydronaphthalene-2,3-diol;hydrobromide | 6-azanyl-5,6,7,8-tetrahydronaphthalene-2,3-diol;hydrobromide | ADTN | ADTN, (+) | CA inhibitor, 3 | CHEMBL26736 | MLS002172466 | SMR001254097 | cid_11957526 | cid_3153
TypeSmall organic molecule
Emp. Form.C10H13NO2
Mol. Mass.179.2157
SMILESNC1CCc2cc(O)c(O)cc2C1
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least:
n/a