Target
HIV-1 protease
Ligand
BDBM519
Substrate
n/a
Meas. Tech.
Inhibition Assay
Ki
0.07±0.0 nM
Citation
 Chellappan, SKiran Kumar Reddy, GSAli, ANalam, MNAnjum, SGCao, HKairys, VFernandes, MXAltman, MDTidor, BRana, TMSchiffer, CAGilson, MK Design of mutation-resistant HIV protease inhibitors with the substrate envelope hypothesis. Chem Biol Drug Des 69:298-313 (2007) [PubMed]  Article
Target
Name:
HIV-1 protease
Synonyms:
n/a
Type:
Protein
Mol. Mass.:
10653.94
Organism:
Human immunodeficiency virus
Description:
O90783
Residue:
98
Sequence:
PQVTLWQRPLVTIRVGGQLKEALLDTGADDTVLEDMNLPGRWKPKMIGGIGGFIKVRQYDQITVEICGHKAIGTVLVGPTPVNIIGRNLLTIGCTLNF
  
Inhibitor
Name:
BDBM519
Synonyms:
(2S)-N-[(2S,3R)-4-[(3S,4aS,8aS)-3-(tert-butylcarbamoyl)-decahydroisoquinolin-2-yl]-3-hydroxy-1-phenylbutan-2-yl]-2-(quinolin-2-ylformamido)butanediamide | CHEMBL114 | Fortovase | Invirase | Ro 31-8959 | SQV | Saquinavir
Type:
Small organic molecule
Emp. Form.:
n/a
Mol. Mass.:
n/a
SMILES:
n/a
Structure:
Search PDB for entries with ligand similarity: