Ki Summary BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetDopamine D2 receptor/Serotonin 2 (5-HT2) receptor
LigandBDBM50016900
Substrate/Competitorn/a
Ki>10000±n/a nM
CommentsPDSP_520
Citation Levant, BGrigoriadis, DEDeSouza, EB Characterization of [3H]quinpirole binding to D2-like dopamine receptors in rat brain. J Pharmacol Exp Ther262:929-35 (1992) [PubMed]
More Info.:Get all data from this article
 
Dopamine D2 receptor/Serotonin 2 (5-HT2) receptor
Name:Dopamine D2 receptor and Serotonin 2a receptor (D2 and 5HT2a)
Synonyms:DOPAMINE D2 | DOPAMINE D2 Long | DOPAMINE D2 Short | DOPAMINE D2/D4 | DRD2 | Dopamine D2 receptor | Dopamine2-like
Type:G Protein-Coupled Receptor (GPCR)
Mol. Mass.:50931.60
Organism:Rattus norvegicus (rat)
Description:Receptor binding assays were performed using rat striatal membranes.
Residue:444
Sequence:
MDPLNLSWYDDDLERQNWSRPFNGSEGKADRPHYNYYAMLLTLLIFIIVFGNVLVCMAVS
REKALQTTTNYLIVSLAVADLLVATLVMPWVVYLEVVGEWKFSRIHCDIFVTLDVMMCTA
SILNLCAISIDRYTAVAMPMLYNTRYSSKRRVTVMIAIVWVLSFTISCPLLFGLNNTDQN
ECIIANPAFVVYSSIVSFYVPFIVTLLVYIKIYIVLRKRRKRVNTKRSSRAFRANLKTPL
KGNCTHPEDMKLCTVIMKSNGSFPVNRRRMDAARRAQELEMEMLSSTSPPERTRYSPIPP
SHHQLTLPDPSHHGLHSNPDSPAKPEKNGHAKIVNPRIAKFFEIQTMPNGKTRTSLKTMS
RRKLSQQKEKKATQMLAIVLGVFIICWLPFFITHILNIHCDCNIPPVLYSAFTWLGYVNS
AVNPIIYTTFNIEFRKAFMKILHC
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50016900
NameBDBM50016900
Synonyms:(E)-N-[2-(3-Dimethylamino-propylsulfanyl)-phenyl]-3-phenyl-acrylamide | CHEMBL18786 | CINANSERIN | N-(2-(3-(dimethylamino)propylthio)phenyl)cinnamamide | N-[2-(3-Dimethylamino-propylsulfanyl)-phenyl]-3-phenyl-acrylamide | N-[2-(3-Dimethylamino-propylsulfanyl)-phenyl]-3-phenyl-acrylamide (cinanserin) | N-[2-(3-Dimethylamino-propylsulfanyl)-phenyl]-3-phenyl-acrylamide(Cinanserin)
TypeSmall organic molecule
Emp. Form.C20H24N2OS
Mol. Mass.340.482
SMILESCN(C)CCCSc1ccccc1NC(=O)\C=C\c1ccccc1
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least:
n/a