Ki Summary BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetHTR2C
LigandBDBM50056401
Substrate/Competitorn/a
Ki 3981.07±n/a nM
CommentsPDSP_1689
Citation Buchheit, KHGamse, RPfannkuche, HJ SDZ 205-557, a selective, surmountable antagonist for 5-HT4 receptors in the isolated guinea pig ileum. Naunyn Schmiedebergs Arch Pharmacol345:387-93 (1992) [PubMed]
More Info.:Get all data from this article
 
HTR2C
Name:HTR2C
Synonyms:5-HT2C
Type:Enzyme Catalytic Domain
Mol. Mass.:51519.58
Organism:PIG
Description:G7ZKZ7
Residue:457
Sequence:
MVNLRKAVHSFLVHLIGLLVWQCDISVSPVAAIVTDIFNTSDGGRFKFPDGVQNWPALSI
VIIIILTIGGNILVIMAVSLEKKLHNATNYFLMSLAIADMLVGLLVMPLSLLAILYDYVW
PLPRYLCPVWISLDVLFSTASIMHLCAISLDRYVAVRGPVEHSRFNSRTKAIMKIAIVWA
ISLGVSVPIPVIGLRDEDKVFVNNTTCVLNDPNFVLIGSFVAFFIPLTIMVITYCLTIHV
LRRQALMLLRGHTEEPPGISLDFLKCCKRNTDEESAANPNQDLNPRRRKKKERRPRGTMQ
AINNERKASKVLGIVFFVFLIMWCPFFITNILSVLCGKACNQKLMEKLLNVFVWIGYVCS
GINPLVYTLFNKVYRRAFSNYLRCNYKADKKPPIRQIPRVAATALSGRELNVNIYRHTNE
PVIKKADDNEPGIEMQVENLELPVNPSNVVSERISSV
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50056401
NameBDBM50056401
Synonyms:2-diethylaminoethyl [2-methoxy-4-amino-5-chloro]benzoate | 4-Amino-5-chloro-2-methoxy-benzoic acid 2-diethylamino-ethyl ester | CHEMBL287045 | SDZ 205557 | SDZ-205557
TypeSmall organic molecule
Emp. Form.C14H21ClN2O3
Mol. Mass.300.781
SMILESCCN(CC)CCOC(=O)c1cc(Cl)c(N)cc1OC
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least:
n/a