Ki Summary BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetAdrenergic receptor alpha-2
LigandBDBM81773
Substrate/Competitorn/a
Ki 26±n/a nM
CommentsPDSP_340
Citation Blaxall, HSMurphy, TJBaker, JCRay, CBylund, DB Characterization of the alpha-2C adrenergic receptor subtype in the opossum kidney and in the OK cell line. J Pharmacol Exp Ther259:323-9 (1991) [PubMed]
More Info.:Get all data from this article
 
Adrenergic receptor alpha-2
Name:Adrenergic receptor alpha
Synonyms:ADRA2B | Alpha-2B adrenergic receptor | Alpha-2B adrenoceptor | Alpha-2B adrenoreceptor | adrenergic Alpha2B
Type:Enzyme Catalytic Domain
Mol. Mass.:50379.83
Organism:NEONATAL RAT
Description:adrenergic Alpha2B ADRA2B NEONATAL RAT::P19328
Residue:453
Sequence:
MSGPTMDHQEPYSVQATAAIASAITFLILFTIFGNALVILAVLTSRSLRAPQNLFLVSLA
AADILVATLIIPFSLANELLGYWYFWRAWCEVYLALDVLFCTSSIVHLCAISLDRYWAVS
RALEYNSKRTPRRIKCIILTVWLIAAVISLPPLIYKGDQRPEPRGLPQCELNQEAWYILA
SSIGSFFAPCLIMILVYLRIYVIAKRSHCRGLGAKRGSGEGESKKPQPVAGGVPTSAKVP
TLVSPLSSVGEANGHPKPPREKEEGETPEDPEARALPPTWSALPRSGQGQKKGTSGATAE
EGDEEDEEEVEECEPQTLPASPASVCNPPLQQPQTSRVLATLRGQVLLGKNVGVASGQWW
RRRTQLSREKRFTFVLAVVIGVFVVCWFPFFFSYSLGAICPQHCKVPHGLFQFFFWIGYC
NSSLNPVIYTVFNQDFRRAFRRILCRPWTQTGW
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM81773
NameBDBM81773
Synonyms:BAM 1303 | BAM-1303 | CAS_115219-10-8
TypeSmall organic molecule
Emp. Form.C25H25BrN4
Mol. Mass.461.397
SMILESCN1C[C@H](Cn2ccnc2-c2ccccc2)C[C@H]2[C@H]1Cc1c(Br)[nH]c3cccc2c13 |r|
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least:
n/a