Ki Summary BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetADRA2C
LigandBDBM81805
Substrate/Competitorn/a
Ki 14±n/a nM
CommentsPDSP_338
Citation Blaxall, HSMurphy, TJBaker, JCRay, CBylund, DB Characterization of the alpha-2C adrenergic receptor subtype in the opossum kidney and in the OK cell line. J Pharmacol Exp Ther259:323-9 (1991) [PubMed]
More Info.:Get all data from this article
 
ADRA2C
Name:ADRA2C
Synonyms:adrenergic Alpha2C
Type:Enzyme Catalytic Domain
Mol. Mass.:27257.01
Organism:OK
Description:adrenergic Alpha2C ADRA2C OK::G3GWB4
Residue:230
Sequence:
MAYWYFGQVWCGVYLALDVLFCTSSIVHLCAISLDRYWSVTQAVEYNLKRTPRRVKATIV
AVWLISAVISFPPLVSFYRRSDGAAYPQCGLNDETWYILSSCIGSFFAPCLIMGLVYARI
YRFFLSRRRRARSSVCRRKVAQAREKRFTFVLAVVMGVFVLCWFPFFFSYSLYGICREAC
QLPEPLFKFFFWIGYCKSSLNPVIYTVFNQDFRRSFKHILFRRRRRGFRQ
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM81805
NameBDBM81805
Synonyms:AZAPETINE | CAS_130-83-6 | NSC_8966
TypeSmall organic molecule
Emp. Form.C17H17N
Mol. Mass.235.3236
SMILESC=CCN1Cc2ccccc2-c2ccccc2C1
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least:
n/a