Ki Summary BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetADRA2C
LigandBDBM29568
Substrate/Competitorn/a
Ki 36±n/a nM
CommentsPDSP_1528
Citation Blaxall, HSMurphy, TJBaker, JCRay, CBylund, DB Characterization of the alpha-2C adrenergic receptor subtype in the opossum kidney and in the OK cell line. J Pharmacol Exp Ther259:323-9 (1991) [PubMed]
More Info.:Get all data from this article
 
ADRA2C
Name:ADRA2C
Synonyms:Alpha-2C adrenergic receptor | adrenergic Alpha2C
Type:Enzyme Catalytic Domain
Mol. Mass.:53254.77
Organism:OPOSSUM
Description:adrenergic Alpha2C ADRA2C OPOSSUM::P35405
Residue:469
Sequence:
MDLQLTTNSTDSGDRGGSSNESLQRQPPSQYSPAEVAGLAAVVSFLIVFTIVGNVLVVIA
VLTSRALKAPQNLFQVSLASADILVATLVMPFSLANELMNYWYFGKVWCVIYLALDVLFC
TSSIVHLCAISLDRYWSVTQAVEYNLKRTPRRIKGIIVTVWLISAVISFPPLISLYRDPE
DDLYPQCELNDETWYILSSCIGSFFAPCIIMVLVYVRIYRVAKLRTRTLSEKRTVPEGSS
QTENGLSRPPVGAGPSTAAAAAASLRLQAGENGHYHLHHHHHHLHHHHHHHHHQLRKSAE
LEDIELEESSTSENRRRRRSREEAAARKGSRGFSFSFSSTKGGQSAGAGSRLSRASNRSL
EFFSTHRRRKRSSLCRRKVTQAREKRFTFVLAVVMGVFVVCWFPFFFTYSLYGICREACQ
VPETLFKFFFWIGYCNSSLNPVIYTIFNQDFRRSFKHILFKKKKKTSLQ
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM29568
NameBDBM29568
Synonyms:CHEMBL2 | PRAZOSIN | PRAZOSIN HYDROCHLORIDE | [3H]-Furazosin | [3H]-Minipress | [3H]-Pratsiol | [3H]-Prazosin
Typeradiolabeled ligand
Emp. Form.C19H21N5O4
Mol. Mass.383.4011
SMILESCOc1cc2nc(nc(N)c2cc1OC)N1CCN(CC1)C(=O)c1ccco1
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least:
n/a