Ki Summary BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetADRA2C
LigandBDBM81816
Substrate/Competitorn/a
Ki 0.46±n/a nM
CommentsPDSP_1970
Citation Blaxall, HSMurphy, TJBaker, JCRay, CBylund, DB Characterization of the alpha-2C adrenergic receptor subtype in the opossum kidney and in the OK cell line. J Pharmacol Exp Ther259:323-9 (1991) [PubMed]
More Info.:Get all data from this article
 
ADRA2C
Name:ADRA2C
Synonyms:adrenergic Alpha2C
Type:Enzyme Catalytic Domain
Mol. Mass.:27257.01
Organism:OK
Description:adrenergic Alpha2C ADRA2C OK::G3GWB4
Residue:230
Sequence:
MAYWYFGQVWCGVYLALDVLFCTSSIVHLCAISLDRYWSVTQAVEYNLKRTPRRVKATIV
AVWLISAVISFPPLVSFYRRSDGAAYPQCGLNDETWYILSSCIGSFFAPCLIMGLVYARI
YRFFLSRRRRARSSVCRRKVAQAREKRFTFVLAVVMGVFVLCWFPFFFSYSLYGICREAC
QLPEPLFKFFFWIGYCKSSLNPVIYTVFNQDFRRSFKHILFRRRRRGFRQ
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM81816
NameBDBM81816
Synonyms:AC1L33GU | AR-1K2981 | CAS_82059-49-2 | N-[(2S,11bR)-2,3,4,6,7,11b-hexahydro-1H-benzo[a]quinolizin-2-yl]-N-methylbutane-1-sulfonamide hydrochloride | WY26703
TypeSmall organic molecule
Emp. Form.C18H28N2O2S
Mol. Mass.336.492
SMILESCCCCS(=O)(=O)N(C)[C@H]1CCN2CCc3ccccc3[C@H]2C1
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least:
n/a