Ki Summary BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetMuscarinic acetylcholine receptor M3
LigandBDBM16173
Substrate/Competitorn/a
Ki>10000±n/a nM
CommentsPDSP_2650
Citation Garritsen, AIjzerman, APTulp, MTCragoe, EJSoudijn, W Receptor binding profiles of amiloride analogues provide no evidence for a link between receptors and the Na+/H+ exchanger, but indicate a common structure on receptor proteins. J Recept Res11:891-907 (1991) [PubMed]
More Info.:Get all data from this article
 
Muscarinic acetylcholine receptor M3
Name:Muscarinic acetylcholine receptor M3
Synonyms:Cholinergic, muscarinic M3
Type:Enzyme Catalytic Domain
Mol. Mass.:66086.66
Organism:RAT
Description:Cholinergic, muscarinic M3 CHRM3 RAT::P08483
Residue:589
Sequence:
MTLHSNSTTSPLFPNISSSWVHSPSEAGLPLGTVTQLGSYNISQETGNFSSNDTSSDPLG
GHTIWQVVFIAFLTGFLALVTIIGNILVIVAFKVNKQLKTVNNYFLLSLACADLIIGVIS
MNLFTTYIIMNRWALGNLACDLWLSIDYVASNASVMNLLVISFDRYFSITRPLTYRAKRT
TKRAGVMIGLAWVISFVLWAPAILFWQYFVGKRTVPPGECFIQFLSEPTITFGTAIAAFY
MPVTIMTILYWRIYKETEKRTKELAGLQASGTEAEAENFVHPTGSSRSCSSYELQQQGVK
RSSRRKYGRCHFWFTTKSWKPSAEQMDQDHSSSDSWNNNDAAASLENSASSDEEDIGSET
RAIYSIVLKLPGHSSILNSTKLPSSDNLQVSNEDLGTVDVERNAHKLQAQKSMGDGDNCQ
KDFTKLPIQLESAVDTGKTSDTNSSADKTTATLPLSFKEATLAKRFALKTRSQITKRKRM
SLIKEKKAAQTLSAILLAFIITWTPYNIMVLVNTFCDSCIPKTYWNLGYWLCYINSTVNP
VCYALCNKTFRTTFKTLLLCQCDKRKRRKQQYQQRQSVIFHKRVPEQAL
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM16173
NameBDBM16173
Synonyms:3,5-diamino-6-chloro-N-(diaminomethylene)pyrazinamide;hydrochloride | 3,5-diamino-N-carbamimidoyl-6-chloropyrazine-2-carboxamide | Amiloride | Amipramidin | CHEMBL945
TypeSmall organic molecule
Emp. Form.C6H8ClN7O
Mol. Mass.229.627
SMILESNC(=N)NC(=O)c1nc(Cl)c(N)nc1N
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least:
n/a