Ki Summary BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetGamma-aminobutyric acid receptor subunit alpha-1 (GABA(A) alpha-1)
LigandBDBM16173
Substrate/Competitorn/a
Ki>10000±n/a nM
CommentsPDSP_2650
Citation Garritsen, AIjzerman, APTulp, MTCragoe, EJSoudijn, W Receptor binding profiles of amiloride analogues provide no evidence for a link between receptors and the Na+/H+ exchanger, but indicate a common structure on receptor proteins. J Recept Res11:891-907 (1991) [PubMed]
More Info.:Get all data from this article
 
Gamma-aminobutyric acid receptor subunit alpha-1 (GABA(A) alpha-1)
Name:Gamma-aminobutyric acid receptor subunit alpha-1 (GABA(A) alpha-1)
Synonyms:Benzodiazepine receptors | GABA A Alpha1Beta2Gamma2 | GABA A Benzodiazepine | GABA A Benzodiazepine Type I | GABA A Benzodiazepine Type II | GABA A Benzodiazepine Type IIL | GABA A Benzodiazepine Type IIM | GABA A Benzodiazepine omega1 | GABA A Benzodiazepine omega2 | GABA A Benzodiazepine omega5 | GABA A alpha1 | GABA A anti-Alpha1 | GABA receptor alpha-1 subunit | GABA, Chloride, TBOB | GABA-PICROTOXIN | Gamma-aminobutyric acid receptor subunit alpha-1 | TBPS
Type:Enzyme
Mol. Mass.:51770.21
Organism:Rattus norvegicus (Rat)
Description:P62813
Residue:455
Sequence:
MKKSRGLSDYLWAWTLILSTLSGRSYGQPSQDELKDNTTVFTRILDRLLDGYDNRLRPGL
GERVTEVKTDIFVTSFGPVSDHDMEYTIDVFFRQSWKDERLKFKGPMTVLRLNNLMASKI
WTPDTFFHNGKKSVAHNMTMPNKLLRITEDGTLLYTMRLTVRAECPMHLEDFPMDAHACP
LKFGSYAYTRAEVVYEWTREPARSVVVAEDGSRLNQYDLLGQTVDSGIVQSSTGEYVVMT
THFHLKRKIGYFVIQTYLPCIMTVILSQVSFWLNRESVPARTVFGVTTVLTMTTLSISAR
NSLPKVAYATAMDWFIAVCYAFVFSALIEFATVNYFTKRGYAWDGKSVVPEKPKKVKDPL
IKKNNTYAPTATSYTPNLARGDPGLATIAKSATIEPKEVKPETKPPEPKKTFNSVSKIDR
LSRIAFPLLFGIFNLVYWATYLNREPQLKAPTPHQ
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM16173
NameBDBM16173
Synonyms:3,5-diamino-6-chloro-N-(diaminomethylene)pyrazinamide;hydrochloride | 3,5-diamino-N-carbamimidoyl-6-chloropyrazine-2-carboxamide | Amiloride | Amipramidin | CHEMBL945
TypeSmall organic molecule
Emp. Form.C6H8ClN7O
Mol. Mass.229.627
SMILESNC(=N)NC(=O)c1nc(Cl)c(N)nc1N
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least:
n/a