Ki Summary BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetDRD2
LigandBDBM81195
Substrate/Competitorn/a
Ki 24±n/a nM
CommentsPDSP_239
Citation Van Tol, HHBunzow, JRGuan, HCSunahara, RKSeeman, PNiznik, HBCivelli, O Cloning of the gene for a human dopamine D4 receptor with high affinity for the antipsychotic clozapine. Nature350:610-4 (1991) [PubMed]  Article
More Info.:Get all data from this article
 
DRD2
Name:DRD2
Synonyms:DOPAMINE D2 Long | DOPAMINE D4 | Dopamine receptor D4
Type:Enzyme Catalytic Domain
Mol. Mass.:43731.97
Organism:CANINE
Description:Q589Y6
Residue:421
Sequence:
AGDADGLLAGRGPGAGTPGTPGAAAALAGGVLLIGAVLAGNALVCASVAAERALQTPTNY
FIVSLAAADLLLALLVLPLFVYSEVQGGVWLFSPGLCDALMAMDVMLCTASIFNLCAISV
DRFVAVAVPLSYNRQGGGGRQLLLIGATWLLSAAVAAPVLCGLNDARGRDPAVCRLEDRD
YVVYSSVCSFFLPCPLMLLLYWATFRGLRRWEAARRAKLHGRTPRRPSGPGPPPPDGSPD
GTPGPPPPDGSPDGTSDGTPGPPPPDGSPDGTPGPPPPDGSPDDNPRPPPPDSSPGPPPP
EVTPDDTPDATPRPLPPAADAAAPPPADPAEPPRQPRKRRRAKITGRERKAMRVLPVVVG
AFLLCWTPFFVVHITRALCPACPVPPRLVSAVTWLGYVNSALNPLIYTVFNAEFRAVFRK
A
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM81195
NameBDBM81195
Synonyms:(+/-)-2-Amino-6,7-dihydroxy-1,2,3,4-tetrahydronaphthalene hydrobromide | 2-aminotetralin-6,7-diol;hydrobromide | 6-Amino-5,6,7,8-tetrahydro-naphthalene-2,3-diol | 6-amino-5,6,7,8-tetrahydronaphthalene-2,3-diol;hydrobromide | 6-azanyl-5,6,7,8-tetrahydronaphthalene-2,3-diol;hydrobromide | ADTN | ADTN, (+) | CA inhibitor, 3 | CHEMBL26736 | MLS002172466 | SMR001254097 | cid_11957526 | cid_3153
TypeSmall organic molecule
Emp. Form.C10H13NO2
Mol. Mass.179.2157
SMILESNC1CCc2cc(O)c(O)cc2C1
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least:
n/a