Ki Summary BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetHTR1D
LigandBDBM30130
Substrate/Competitorn/a
Ki 4265.79±n/a nM
CommentsPDSP_830
Citation Wong, DTThrelkeld, PGRobertson, DW Affinities of fluoxetine, its enantiomers, and other inhibitors of serotonin uptake for subtypes of serotonin receptors. Neuropsychopharmacology5:43-7 (1991) [PubMed]
More Info.:Get all data from this article
 
HTR1D
Name:5-hydroxytryptamine 1D receptor (5HT1D)
Synonyms:n/a
Type:Protein
Mol. Mass.:12731.52
Organism:Bos taurus (Bovine)
Description:Q8MI13
Residue:119
Sequence:
SNRSLNATATQGAWDPGTLQALKIALVVLLSIITLATVLSNAFVLTTIFLTRKLHTPANC
LIGSLAMTDLLVSILVMPISIAYTTTHTWSFGQLLCDIWLSSDITCCTASILHLCVIAL
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM30130
NameBDBM30130
Synonyms:CHEMBL1201082 | CHEMBL41 | Fluoxetin | Fluoxetine | Prozac | US9120771, Fluoxetine | cid_62857
TypeSmall organic molecule
Emp. Form.C17H18F3NO
Mol. Mass.309.3261
SMILESCNCCC(Oc1ccc(cc1)C(F)(F)F)c1ccccc1
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least:
n/a