Ki Summary BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetDopamine D2 receptor/Serotonin 2 (5-HT2) receptor
LigandBDBM55121
Substrate/Competitorn/a
Ki 474±n/a nM
CommentsPDSP_728
Citation Sokoloff, PGiros, BMartres, MPBouthenet, MLSchwartz, JC Molecular cloning and characterization of a novel dopamine receptor (D3) as a target for neuroleptics. Nature347:146-51 (1990) [PubMed]  Article
More Info.:Get all data from this article
 
Dopamine D2 receptor/Serotonin 2 (5-HT2) receptor
Name:Dopamine D2 receptor and Serotonin 2a receptor (D2 and 5HT2a)
Synonyms:DOPAMINE D2 | DOPAMINE D2 Long | DOPAMINE D2 Short | DOPAMINE D2/D4 | DRD2 | Dopamine D2 receptor | Dopamine2-like
Type:G Protein-Coupled Receptor (GPCR)
Mol. Mass.:50931.60
Organism:Rattus norvegicus (rat)
Description:Receptor binding assays were performed using rat striatal membranes.
Residue:444
Sequence:
MDPLNLSWYDDDLERQNWSRPFNGSEGKADRPHYNYYAMLLTLLIFIIVFGNVLVCMAVS
REKALQTTTNYLIVSLAVADLLVATLVMPWVVYLEVVGEWKFSRIHCDIFVTLDVMMCTA
SILNLCAISIDRYTAVAMPMLYNTRYSSKRRVTVMIAIVWVLSFTISCPLLFGLNNTDQN
ECIIANPAFVVYSSIVSFYVPFIVTLLVYIKIYIVLRKRRKRVNTKRSSRAFRANLKTPL
KGNCTHPEDMKLCTVIMKSNGSFPVNRRRMDAARRAQELEMEMLSSTSPPERTRYSPIPP
SHHQLTLPDPSHHGLHSNPDSPAKPEKNGHAKIVNPRIAKFFEIQTMPNGKTRTSLKTMS
RRKLSQQKEKKATQMLAIVLGVFIICWLPFFITHILNIHCDCNIPPVLYSAFTWLGYVNS
AVNPIIYTTFNIEFRKAFMKILHC
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM55121
NameBDBM55121
Synonyms:3-HYDROXYTYRAMINE HYDROCHLORIDE | 4-(2-aminoethyl)benzene-1,2-diol;hydrochloride | 4-(2-aminoethyl)pyrocatechol;hydrochloride | 4-(2-azanylethyl)benzene-1,2-diol;hydrochloride | DOPAMINE | Dopamine | MLS000069419 | SMR000059081 | cid_65340
TypeSmall organic molecule
Emp. Form.C8H11NO2
Mol. Mass.153.1784
SMILESNCCc1ccc(O)c(O)c1
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least:
n/a