Ki Summary BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetDopamine receptor
LigandBDBM55121
Substrate/Competitorn/a
Ki 25±n/a nM
CommentsPDSP_728
Citation Sokoloff, PGiros, BMartres, MPBouthenet, MLSchwartz, JC Molecular cloning and characterization of a novel dopamine receptor (D3) as a target for neuroleptics. Nature347:146-51 (1990) [PubMed]  Article
More Info.:Get all data from this article
 
Dopamine receptor
Name:Dopamine receptor D2 and D3
Synonyms:D(3) dopamine receptor | DOPAMINE D3 | DRD3 | Dopamine D3 receptor
Type:Protein
Mol. Mass.:49540.58
Organism:Rattus norvegicus (Rat)
Description:P19020
Residue:446
Sequence:
MAPLSQISTHLNSTCGAENSTGVNRARPHAYYALSYCALILAIIFGNGLVCAAVLRERAL
QTTTNYLVVSLAVADLLVATLVMPWVVYLEVTGGVWNFSRICCDVFVTLDVMMCTASILN
LCAISIDRYTAVVMPVHYQHGTGQSSCRRVALMITAVWVLAFAVSCPLLFGFNTTGDPSI
CSISNPDFVIYSSVVSFYVPFGVTVLVYARIYIVLRQRQRKRILTRQNSQCISIRPGFPQ
QSSCLRLHPIRQFSIRARFLSDATGQMEHIEDKQYPQKCQDPLLSHLQPPSPGQTHGGLK
RYYSICQDTALRHPSLEGGAGMSPVERTRNSLSPTMAPKLSLEVRKLSNGRLSTSLRLGP
LQPRGVPLREKKATQMVVIVLGAFIVCWLPFFLTHVLNTHCQACHVSPELYRATTWLGYV
NSALNPVIYTTFNVEFRKAFLKILSC
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM55121
NameBDBM55121
Synonyms:3-HYDROXYTYRAMINE HYDROCHLORIDE | 4-(2-aminoethyl)benzene-1,2-diol;hydrochloride | 4-(2-aminoethyl)pyrocatechol;hydrochloride | 4-(2-azanylethyl)benzene-1,2-diol;hydrochloride | DOPAMINE | Dopamine | MLS000069419 | SMR000059081 | cid_65340
TypeSmall organic molecule
Emp. Form.C8H11NO2
Mol. Mass.153.1784
SMILESNCCc1ccc(O)c(O)c1
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least:
n/a